Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate WP_092350655.1 BLU87_RS15930 hypothetical protein
Query= SwissProt::P37735 (333 letters) >NCBI__GCF_900107645.1:WP_092350655.1 Length = 333 Score = 137 bits (346), Expect = 3e-37 Identities = 93/301 (30%), Positives = 153/301 (50%), Gaps = 25/301 (8%) Query: 32 KFSHVVAPDTPKGKGAA--KFEELAEKYTNGAVDVEVYPNSQLYKDKEELEALQLGAVQM 89 K HV PD+ AA KF+EL + TN + + ++P QL D+E LE + G + + Sbjct: 32 KLGHVALPDSDNSYHAAALKFKELLAEKTN--IKITIFPQRQLGDDREMLEGVPTGLLDV 89 Query: 90 LAPSLAKFGPLGVQDFEV--FDLPYIFKDYEALHKVTQGEAGKMLLSKLEAKGITGLAFW 147 A +L GP+ + +V +LP++F + + L V G G+ LL LE G GL F+ Sbjct: 90 TAATL---GPVSAFEPKVGLLELPFLFNNLDHLDAVLDGSIGRELLDSLEKAGYKGLGFF 146 Query: 148 DNGFK-IMSANTPLTMPDDFLGLKMRIQSSKVLEAEMNALGAVPQVMAFSEVYQALQTGV 206 D+G I ++ P+ DF GL+MR + V A +LG+ P +A+SE+Y ALQTGV Sbjct: 147 DDGINNITNSKQPIHSAADFKGLQMRTIEAPVRIAVAKSLGSNPVPVAYSELYTALQTGV 206 Query: 207 VDGTENPPSNMFTQKMNEVQKHATVSNHGYLGYAVIVNKQFWDGLPADVRTGLEKAMAES 266 VDG NP + ++ + EVQK+ +V+NH + G +++N + ++ L + + A E+ Sbjct: 207 VDGQSNPNWVISSRSLWEVQKYVSVTNHIWGGAVLVMNLEKFNDLSPQEQELVLAAGKEA 266 Query: 267 TDYANGIAKEENEKALQAMKDAG---------------TTEFHELTAEERAAWEEVLTPV 311 Y + + +K LQ D G T ++ ++ W+ V+ + Sbjct: 267 CQYGRKMGRNAEDKHLQKAIDHGMIVDKTPDLASMRKATASVYDDIYRDQPTWKPVIEEI 326 Query: 312 H 312 H Sbjct: 327 H 327 Lambda K H 0.314 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 333 Length adjustment: 28 Effective length of query: 305 Effective length of database: 305 Effective search space: 93025 Effective search space used: 93025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory