Align Proline dehydrogenase; PRODH; Proline oxidase; TtPRODH; EC 1.5.5.2 (characterized)
to candidate WP_092350667.1 BLU87_RS15955 proline dehydrogenase
Query= SwissProt::Q72IB8 (307 letters) >NCBI__GCF_900107645.1:WP_092350667.1 Length = 302 Score = 174 bits (440), Expect = 3e-48 Identities = 95/272 (34%), Positives = 151/272 (55%), Gaps = 4/272 (1%) Query: 23 LIKHRAKGLVRRYVAGETLEEALKAAEALEREGVHAILDLLGEMVRTEEEARAFQRGLLE 82 +I H AKG Y+AG TL +A++ + L ++G+ +D+LGE + T ++A F+ L Sbjct: 19 IISHFAKG----YIAGSTLADAVQLTKDLNQQGIMTTIDILGEFITTMDQAVGFKNDGLN 74 Query: 83 LVWALAGKPWPKYISLKLTQLGLDLSEDLALALLREVLREAEPRGVFVRLDMEDSPRVEA 142 ++ + + +S+K TQ+GL L ++ ++RE++ EA+ F+R+D+ED P + Sbjct: 75 ILRTIDRENLDANLSIKPTQMGLLLDKEQCYGIIRELVAEAKELKNFIRIDIEDVPVTDD 134 Query: 143 TLRLYRALREEGFSQVGIVLQSYLYRTEKDLLDLLPYRPNLRLVKGAYREPKEVAFPDKR 202 T +R LREE VG LQ YL RT D++ + N RL KG Y E + A+ + Sbjct: 135 TFEFFRRLREEFPGHVGTALQGYLRRTPDDVVAMADGYQNYRLCKGIYIESRMDAWKHPQ 194 Query: 203 LIDAEYLHLGKLALKEGLYVAFATHDPRIIAELKRYTEAMGIPRSRFEFQFLYGVRPEEQ 262 I+ Y+ + LK+G YV ATHD ++ E + + ++EFQ L GV E + Sbjct: 195 AINRNYVICLEQLLKQGAYVGIATHDESLVFEAMNIIRKLDLNPDQYEFQMLLGVDEELR 254 Query: 263 RRLAREGYTVRAYVPYGRDWYPYLTRRIAERP 294 + + G+ +R YVPYG DW PY RR+ E P Sbjct: 255 KIILAAGHRLRIYVPYGEDWLPYSQRRLKENP 286 Lambda K H 0.323 0.141 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 202 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 302 Length adjustment: 27 Effective length of query: 280 Effective length of database: 275 Effective search space: 77000 Effective search space used: 77000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory