Align glutamyl-tRNAGln amidotransferase subunit C (EC 6.3.5.7) (characterized)
to candidate WP_092481822.1 BM299_RS02200 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC
Query= metacyc::MONOMER-13957 (96 letters) >NCBI__GCF_900115975.1:WP_092481822.1 Length = 93 Score = 87.0 bits (214), Expect = 4e-23 Identities = 40/92 (43%), Positives = 62/92 (67%) Query: 4 ISIEEVKHVAHLARLAITEEEAKMFTEQLDSIISFAEELNEVNTDNVEPTTHVLKMKNVM 63 +S +EV+HVA LARL +T+EE + + QL I+ +L +++T+N+ PT HVL ++NV Sbjct: 2 LSPKEVEHVALLARLKLTDEEKETYRRQLSDILDNFRKLQDLDTENIPPTAHVLPLQNVF 61 Query: 64 REDEAGKGLPVEDVMKNAPDHKDGYIRVPSIL 95 RED G + VE V+ NAP +D + +VP I+ Sbjct: 62 REDRVGGHMAVEKVLANAPQRQDNFFKVPKIV 93 Lambda K H 0.312 0.130 0.349 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 48 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 96 Length of database: 93 Length adjustment: 10 Effective length of query: 86 Effective length of database: 83 Effective search space: 7138 Effective search space used: 7138 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.5 bits) S2: 39 (19.6 bits)
Align candidate WP_092481822.1 BM299_RS02200 (Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC)
to HMM TIGR00135 (gatC: aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase, C subunit (EC 6.3.5.-))
../bin/blast/fastacmd -i /tmp/list.23993.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.23993.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.