Align 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase; EC 2.3.1.16 (characterized)
to candidate WP_092482980.1 BM299_RS08135 thiolase family protein
Query= SwissProt::O32177 (391 letters) >NCBI__GCF_900115975.1:WP_092482980.1 Length = 391 Score = 446 bits (1146), Expect = e-130 Identities = 231/390 (59%), Positives = 286/390 (73%), Gaps = 2/390 (0%) Query: 1 MKEAVIVSGARTPVGKAKKGSLATVRPDDLGAICVKETLKRAGGYE-GNIDDLIIGCATP 59 M+EAVIVS RT VGKA +G+L RP+ +GA +KE L R G + IDD I+GC+ P Sbjct: 1 MREAVIVSAVRTAVGKAPRGTLKKTRPEHMGAEVIKELLNRTPGLDPAEIDDFIVGCSFP 60 Query: 60 EAEQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAES 119 EAEQG+N+ R + AGLP TV TVNR+CSSGL+SIA A ++M G D + GG ES Sbjct: 61 EAEQGMNLGRMLVLKAGLPNTVSGATVNRFCSSGLESIAIGATRVMAGFADVYLCGGVES 120 Query: 120 MSQVPMMGHVTRPNLALAEKAPEYYMSMGHTAEQVAKKYGVSREDQDAFAVRSHQNAAKA 179 MS VPM G+ P+ L E PE YM MG TAE VA++YG++RE QD F+V SH AA+A Sbjct: 121 MSIVPMGGNKAMPDPELMEICPEAYMGMGLTAENVAEQYGITREMQDEFSVGSHAKAARA 180 Query: 180 LAEGKFKDEIVPVEVTVTEIGEDHKPMEKQFVFSQDEGVRPQTTADILSTLRPAFSVDGT 239 + EG+FK++IVP+ VT T+ K EK VF DEGVRP T+ + L+ LRP F G+ Sbjct: 181 IQEGRFKEQIVPLTVT-TKTRAKGKLTEKSIVFDTDEGVRPGTSMETLAKLRPVFKTGGS 239 Query: 240 VTAGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFAVGGVPPEVMGIGPVEAIPRAL 299 VTAGNSSQTSDGAAAVM+M REKA++LGL PL FRS+AVGG PPEVMGIGP AIP+AL Sbjct: 240 VTAGNSSQTSDGAAAVMIMSREKAESLGLKPLAVFRSYAVGGCPPEVMGIGPTVAIPKAL 299 Query: 300 KLAGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNVNGGAIALGHPLGCTGTKLTLS 359 KLAG+ + +FELNEAFA+QA+ I+ L +D KVN NGGA+ALGHPLGCTG+KLT Sbjct: 300 KLAGITKDQVDVFELNEAFAAQALACIKVLELDPAKVNPNGGAVALGHPLGCTGSKLTTQ 359 Query: 360 LIHEMKRRNEQFGVVTMCIGGGMGAAGVFE 389 L++EM+R N ++GVV+MCIGGGMGAA VFE Sbjct: 360 LMYEMQRINARYGVVSMCIGGGMGAAAVFE 389 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 391 Length adjustment: 31 Effective length of query: 360 Effective length of database: 360 Effective search space: 129600 Effective search space used: 129600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_092482980.1 BM299_RS08135 (thiolase family protein)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.10720.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-145 470.8 1.5 1.8e-145 470.6 1.5 1.0 1 lcl|NCBI__GCF_900115975.1:WP_092482980.1 BM299_RS08135 thiolase family pr Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900115975.1:WP_092482980.1 BM299_RS08135 thiolase family protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 470.6 1.5 1.8e-145 1.8e-145 1 385 [] 6 389 .. 6 389 .. 0.97 Alignments for each domain: == domain 1 score: 470.6 bits; conditional E-value: 1.8e-145 TIGR01930 1 ivdavRtpig.klggslkelsaedLlaavikellera.gldpekidevilGnvlqageq.aniaReaal 66 iv+avRt++g + +g+lk++++e+++a+vikell+r+ gldp++id+ i+G++++++eq +n++R+ +l lcl|NCBI__GCF_900115975.1:WP_092482980.1 6 IVSAVRTAVGkAPRGTLKKTRPEHMGAEVIKELLNRTpGLDPAEIDDFIVGCSFPEAEQgMNLGRMLVL 74 8*********988******************************************************** PP TIGR01930 67 aaglpesvpaltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkak 135 +aglp++v++ tvnr+C+Sgl+++a++a +++aG adv++ GGvEsmS vp++ +++ + +++ ++ lcl|NCBI__GCF_900115975.1:WP_092482980.1 75 KAGLPNTVSGATVNRFCSSGLESIAIGATRVMAGFADVYLCGGVESMSIVPMGGNKA----MPDPELME 139 ****************************************************98875....67776666 PP TIGR01930 136 ledqllkdlvktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk... 201 ++ + mg tAen+a++ygi+Re+qDe+++ Sh kaa+Ai+eg+fk++ivp++v +k lcl|NCBI__GCF_900115975.1:WP_092482980.1 140 ICP-------EAYMGMGLTAENVAEQYGITREMQDEFSVGSHAKAARAIQEGRFKEQIVPLTVTTKtra 201 666.......8899*************************************************99999* PP TIGR01930 202 .......kkvvskDegirpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgl 263 + v+++Deg+rp+t++e+LakL+p+fk+ gs vtAgNssq++DGAaa+++ms+e+a++lgl lcl|NCBI__GCF_900115975.1:WP_092482980.1 202 kgkltekSIVFDTDEGVRPGTSMETLAKLRPVFKT-GGS-VTAGNSSQTSDGAAAVMIMSREKAESLGL 268 *****99999***********************96.797.***************************** PP TIGR01930 264 tplarivsaavagvdpeemglgpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekv 332 +pla ++s+av g++pe+mg+gp+ Ai+kaLk ag++ +++d++E+nEAFAaq+la++k l+ ld++kv lcl|NCBI__GCF_900115975.1:WP_092482980.1 269 KPLAVFRSYAVGGCPPEVMGIGPTVAIPKALKLAGITKDQVDVFELNEAFAAQALACIKVLE-LDPAKV 336 **************************************************************.99**** PP TIGR01930 333 NvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvggGqGaAvile 385 N nGGA+AlGHPlG++G+ ++++l++e+++ +++yG++++C+ggG+GaA+++e lcl|NCBI__GCF_900115975.1:WP_092482980.1 337 NPNGGAVALGHPLGCTGSKLTTQLMYEMQRINARYGVVSMCIGGGMGAAAVFE 389 ***************************************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (391 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.60 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory