Align UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 (characterized)
to candidate WP_092991400.1 BLP65_RS00130 UDP-glucose 4-epimerase GalE
Query= SwissProt::P21977 (332 letters) >NCBI__GCF_900102855.1:WP_092991400.1 Length = 340 Score = 289 bits (739), Expect = 8e-83 Identities = 155/321 (48%), Positives = 211/321 (65%), Gaps = 6/321 (1%) Query: 2 AILVLGGAGYIGSHMVDRLVEKGQEKVVVVDSLVTGHRAAV-HPDAIFYQGDLSDQDFMR 60 A+LV GGAGYIGSH+V +L E G E+V+V+D+L TG +V H D I GD D+D + Sbjct: 6 AVLVTGGAGYIGSHVVRQLAEVG-ERVIVLDNLSTGFAESVLHGDLIV--GDTGDRDTVL 62 Query: 61 KVFKENPDVDAVIHFAAYSLVGESMEKPLKYFDNNTAGMVKLLEVMNECGVKYIVFSSTA 120 + +E VDAV+HFAA+++V ES+ PLKY+ NNT+ LLE E GVK+ VFSSTA Sbjct: 63 AILREYR-VDAVMHFAAHTVVPESVRDPLKYYGNNTSSTRNLLECCQEAGVKHFVFSSTA 121 Query: 121 ATYGIPEEIPILETTPQNPINPYGESKLMMETIMKWSDQAYGIKYVPLRYFNVAGANLMV 180 A YG P+ E TP PINPYG SKLM E ++ Q + YV RYFNVAG + Sbjct: 122 AVYGTPDGGLASEETPTRPINPYGRSKLMSEWMLHDLSQVTDLNYVTFRYFNVAGCDPYA 181 Query: 181 RLVR-TRSETHLLPIILQVAQGVREKIMIFGDDYNTPDGTNVRDYVHPFDLADAHLLAVE 239 R+ + T + T L+ + + A G R ++ IFG DY TPDGT VRD++H DLA+AH L +E Sbjct: 182 RIGQSTPNATLLIKVACETAIGKRAQLKIFGTDYPTPDGTGVRDFIHVEDLAEAHRLGLE 241 Query: 240 YLRKGNESTAFNLGSSTGFSNLQILEAARKVTGKEIPAEKADRRPGDPDILIASSEKART 299 YLR G +S+ FN G G+S ++L++ ++VTGK + E+ RRPGDP LIA S + Sbjct: 242 YLRNGGDSSVFNCGYGHGYSVREVLDSVQRVTGKSLTIEEVARRPGDPPRLIADSGRLHQ 301 Query: 300 VLGWKPQFDNIEKIIASAWAW 320 LGWKP++D+++ I+ +AW W Sbjct: 302 RLGWKPRYDDLDFIVETAWNW 322 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 340 Length adjustment: 28 Effective length of query: 304 Effective length of database: 312 Effective search space: 94848 Effective search space used: 94848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_092991400.1 BLP65_RS00130 (UDP-glucose 4-epimerase GalE)
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.31292.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-140 453.0 0.0 2.8e-140 452.8 0.0 1.0 1 lcl|NCBI__GCF_900102855.1:WP_092991400.1 BLP65_RS00130 UDP-glucose 4-epim Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900102855.1:WP_092991400.1 BLP65_RS00130 UDP-glucose 4-epimerase GalE # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 452.8 0.0 2.8e-140 2.8e-140 1 328 [. 6 326 .. 6 330 .. 0.99 Alignments for each domain: == domain 1 score: 452.8 bits; conditional E-value: 2.8e-140 TIGR01179 1 kiLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekitevklvegdladkekleavleee 69 ++LvtGgaGyiGshvvrql e g +v+vlDnls+g++e++ +++ l+ gd d+ ++ a+l+e lcl|NCBI__GCF_900102855.1:WP_092991400.1 6 AVLVTGGAGYIGSHVVRQLAEVGERVIVLDNLSTGFAESVLHGD------LIVGDTGDRDTVLAILREY 68 59*****************************************9......******************* PP TIGR01179 70 kidaviHfaaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEesp 138 ++dav+Hfaa + v+Esv++PlkYY nn+++t +Lle++q+agvk+++Fss+aavYg+++ sEe+p lcl|NCBI__GCF_900102855.1:WP_092991400.1 69 RVDAVMHFAAHTVVPESVRDPLKYYGNNTSSTRNLLECCQEAGVKHFVFSSTAAVYGTPDGGLASEETP 137 ********************************************************************* PP TIGR01179 139 lnpinpYGrsklmvErilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknathliklvaevavgkr 207 + pinpYGrsklm+E++l+dl+++ ++l++v RYFnvaG d+ +iG++++nat lik+++e+a+gkr lcl|NCBI__GCF_900102855.1:WP_092991400.1 138 TRPINPYGRSKLMSEWMLHDLSQV-TDLNYVTFRYFNVAGCDPYARIGQSTPNATLLIKVACETAIGKR 205 ************************.******************************************** PP TIGR01179 208 ekleifGtdyptkDGtcvRDyiHveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsg 276 +l+ifGtdypt+DGt+vRD+iHveDlaeaH le+l +gg+s+v+n+G+g+g+sv+ev++ v++v+g lcl|NCBI__GCF_900102855.1:WP_092991400.1 206 AQLKIFGTDYPTPDGTGVRDFIHVEDLAEAHRLGLEYLRNGGDSSVFNCGYGHGYSVREVLDSVQRVTG 274 ********************************************************************* PP TIGR01179 277 kdikveladrRaGDpaslvadaskikrelgwkpkyddLeeiiksawdWekkl 328 k++++e+ +rR+GDp++l+ad+ + +++lgwkp+yddL+ i+++aw+We++ lcl|NCBI__GCF_900102855.1:WP_092991400.1 275 KSLTIEEVARRPGDPPRLIADSGRLHQRLGWKPRYDDLDFIVETAWNWERRV 326 *************************************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (340 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.21 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory