Align acetyl-CoA acetyltransferase (EC 2.3.1.16) (characterized)
to candidate WP_093392702.1 BM091_RS00785 thiolase family protein
Query= metacyc::MONOMER-13468 (393 letters) >NCBI__GCF_900114975.1:WP_093392702.1 Length = 399 Score = 397 bits (1021), Expect = e-115 Identities = 213/395 (53%), Positives = 277/395 (70%), Gaps = 6/395 (1%) Query: 3 EVVIVSAVRTAIGSFGGTLKDVSAVDLGAIVIKEAVKRAGIKPEQVDEVIFGNVIQAGVG 62 ++V+V VRTAIG FGGTLKDV A L A V+K V R GI P +D++I G+ +Q Sbjct: 6 DIVLVGGVRTAIGRFGGTLKDVRASQLAAHVMKAVVDRTGIDPGMLDDIIAGDCLQNADE 65 Query: 63 QSLARQSAVYAGLPVEVPAFTVNKLCGSGLRTVSLAASLISNGDADTIVVGGSENMSASP 122 + AR +A+ AG PV VPA+T+ + C S ++ V+ AA I GDA+ I+V G E+MS++P Sbjct: 66 ANTARTAALLAGFPVHVPAYTIQRQCSSSMQAVASAAQAIKAGDAELIMVVGVESMSSAP 125 Query: 123 YLIPKARFGYRMGEAKIYDAM---LHDGLIDSFNNYHMGITAENIAEKWGITREDQDKFA 179 Y + KAR+G R+ + DA+ LH G MG TAEN+AEK+ I+R +QD+ A Sbjct: 126 YYLSKARWGMRLQHQECTDALWEALHSGSRLLGRPMIMGETAENLAEKYNISRREQDEVA 185 Query: 180 LASQQKAEAAIKAGKFKDEIVPVTVKMKKKEV-VFDTDEDPRFGTTIETLAKLKPAFKRD 238 LAS QKAEAAIKAGKFKDEIVP+ VK K +V VFD DE PRFG T+E LAKL P FK++ Sbjct: 186 LASHQKAEAAIKAGKFKDEIVPIEVKGPKGQVIVFDQDEHPRFGLTLEDLAKLPPVFKKN 245 Query: 239 GTGTVTAGNSSGINDSSAALILMSADKAKELGVKPMAKYVDFASAGLDPAIMGYGPYYAT 298 GT VTAGNSSGIND +AA ++ + KA+ELG++P+ + V A AG++P MGYGP AT Sbjct: 246 GT--VTAGNSSGINDGAAAALITTRRKARELGLEPLVRIVATAVAGVEPEFMGYGPVPAT 303 Query: 299 KKVLAKTNLTIKDFDLIEANEAFAAQSIAVARDLEFDMSKVNVNGGAIALGHPVGCSGAR 358 +KVL K +T+K+ +LIE NEAFAAQ IA R L D S NVNG I+LGHPVGC+G R Sbjct: 304 QKVLKKAGMTLKNVELIELNEAFAAQYIACERGLGIDRSITNVNGSGISLGHPVGCTGLR 363 Query: 359 ILVTLLHEMQKRDAKKGLATLCIGGGQGTAVVVER 393 I+++L +EM++RD GLATLC+GGG G A +V R Sbjct: 364 IIISLAYEMKRRDLNVGLATLCVGGGMGMATIVAR 398 Lambda K H 0.316 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 399 Length adjustment: 31 Effective length of query: 362 Effective length of database: 368 Effective search space: 133216 Effective search space used: 133216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_093392702.1 BM091_RS00785 (thiolase family protein)
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.3696786.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-146 474.0 3.1 1.9e-146 473.8 3.1 1.0 1 NCBI__GCF_900114975.1:WP_093392702.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_900114975.1:WP_093392702.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 473.8 3.1 1.9e-146 1.9e-146 2 384 .. 10 396 .. 9 397 .. 0.98 Alignments for each domain: == domain 1 score: 473.8 bits; conditional E-value: 1.9e-146 TIGR01930 2 vdavRtpigklggslkelsaedLlaavikelleragldpekidevilGnvlqageqaniaReaalaaglpesv 74 v++vRt+ig++gg+lk+++a++L+a+v+k++++r+g+dp +d++i G lq++++an+aR+aal ag+p +v NCBI__GCF_900114975.1:WP_093392702.1 10 VGGVRTAIGRFGGTLKDVRASQLAAHVMKAVVDRTGIDPGMLDDIIAGDCLQNADEANTARTAALLAGFPVHV 82 89*********************************************************************** PP TIGR01930 75 paltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledqllkdl... 144 pa+t++r+C+S++qAva+aaq+ikaG+a+++++ GvEsmS++p++l+++ r++++l++++ d+l + l NCBI__GCF_900114975.1:WP_093392702.1 83 PAYTIQRQCSSSMQAVASAAQAIKAGDAELIMVVGVESMSSAPYYLSKA--RWGMRLQHQECTDALWEALhsg 153 ***********************************************98..8999999999999888888999 PP TIGR01930 145 ...vktklsmgetAenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk...kkvvskDegi 211 + mgetAenla+ky+isR+eqDe al+Shqka++Ai++gkfkdeivp+evkg v+++De++ NCBI__GCF_900114975.1:WP_093392702.1 154 srlLGRPMIMGETAENLAEKYNISRREQDEVALASHQKAEAAIKAGKFKDEIVPIEVKGPkgqVIVFDQDEHP 226 99966789**************************************************999988999****** PP TIGR01930 212 rpnttlekLakLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivsaavagvdpeemgl 284 r ++tle+LakL+p+fk+ +g tvtAgNss++nDGAaa+l++++++a+elgl+pl riv++avagv+pe mg+ NCBI__GCF_900114975.1:WP_093392702.1 227 RFGLTLEDLAKLPPVFKK-NG-TVTAGNSSGINDGAAAALITTRRKARELGLEPLVRIVATAVAGVEPEFMGY 297 ****************95.9*.6************************************************** PP TIGR01930 285 gpvpAiekaLkkaglsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiAlGHPlGasGarivltll 357 gpvpA++k+Lkkag+++++++l+E+nEAFAaq++a+e+ lg +d++ NvnG+ i+lGHP+G++G ri+++l+ NCBI__GCF_900114975.1:WP_093392702.1 298 GPVPATQKVLKKAGMTLKNVELIELNEAFAAQYIACERGLG-IDRSITNVNGSGISLGHPVGCTGLRIIISLA 369 *****************************************.88***************************** PP TIGR01930 358 keLkergkkyGlatlCvggGqGaAvil 384 +e+k+r+ ++GlatlCvggG+G+A+i+ NCBI__GCF_900114975.1:WP_093392702.1 370 YEMKRRDLNVGLATLCVGGGMGMATIV 396 *************************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (399 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 21.68 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory