GapMind for catabolism of small carbon sources

 

Protein WP_093393372.1 in Thermodesulforhabdus norvegica DSM 9990

Annotation: NCBI__GCF_900114975.1:WP_093393372.1

Length: 321 amino acids

Source: GCF_900114975.1 in NCBI

Candidate for 19 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-isoleucine catabolism livM hi High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M (characterized) 40% 80% 225.7 BraE aka Bra2E, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC 31% 162.9
L-leucine catabolism livM hi High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M (characterized) 40% 80% 225.7 BraE aka Bra2E, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC 31% 162.9
L-phenylalanine catabolism livM hi High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M (characterized) 40% 80% 225.7 ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM 38% 200.3
L-valine catabolism livM hi High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M (characterized) 40% 80% 225.7 BraE aka Bra2E, component of General L- (and D-)amino acid uptake porter (transports acidic, basic, polar, semipolar and hydrophobic amino acids). The amino and carboxyl groups do not need to be α since γ-aminobutyric acid (GABA) is a substrate. The system may function with additional binding proteins since L-alanine uptake is not dependent on BraC 31% 162.9
L-alanine catabolism braE med High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 42% 77% 233.8 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 40% 225.7
L-serine catabolism braE med High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 42% 77% 233.8 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 40% 225.7
L-threonine catabolism braE med High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 42% 77% 233.8 High-affinity branched-chain amino acid transport system permease protein LivM; LIV-I protein M 40% 225.7
D-alanine catabolism AZOBR_RS08240 lo Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale) 42% 62% 239.6 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 42% 237.3
L-proline catabolism AZOBR_RS08240 lo Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale) 42% 62% 239.6 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 42% 237.3
L-proline catabolism HSERO_RS00890 lo ABC transporter ATP-binding protein (characterized, see rationale) 39% 94% 224.9 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 42% 237.3
L-serine catabolism Ac3H11_1694 lo ABC transporter ATP-binding protein (characterized, see rationale) 39% 94% 224.9 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 42% 237.3
L-tyrosine catabolism Ac3H11_1694 lo ABC transporter ATP-binding protein (characterized, see rationale) 39% 94% 224.9 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 42% 237.3
L-arginine catabolism braE lo Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 35% 76% 213.4 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 42% 237.3
L-glutamate catabolism braE lo Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 35% 76% 213.4 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 42% 237.3
L-histidine catabolism braE lo Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale) 35% 76% 213.4 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 42% 237.3
L-isoleucine catabolism natC lo NatC, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 59% 87.4 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 42% 237.3
L-leucine catabolism natC lo NatC, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 59% 87.4 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 42% 237.3
L-proline catabolism natC lo NatC, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 59% 87.4 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 42% 237.3
L-valine catabolism natC lo NatC, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 31% 59% 87.4 High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine 42% 237.3

Sequence Analysis Tools

View WP_093393372.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MKPDKRTLLTAVFLVTFFVVPLFLNPYWVDVLVNVGIYALLGLSLNLIVGHAGLFNLGHA
AFYAVGAYTAAILNTKFHIPLLWILPVSGLAAGIFALIIARPIIHLRGDYLCIVTIGVGE
IVRIALINNVFGITGGANGIFGISRPQIFGYVIKTPYQFFYLVWVFVLITVVLFRRLENS
RVGRALNYLREDEVAAEGCGVNVAHYKLLCFVIGAAWAGMVGNIYAGKMILISPESFSFW
ESVIMFTLVILGGAGSIEGVILGAFLIVGLPEIFRELADARMLFFGAAMIVMMIFRPEGL
IPARRRVYRLPSGSAGGFLAE

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory