Align 3-isopropylmalate dehydratase (EC 4.2.1.33) (characterized)
to candidate WP_093393430.1 BM091_RS03265 3-isopropylmalate dehydratase small subunit
Query= BRENDA::Q58673 (168 letters) >NCBI__GCF_900114975.1:WP_093393430.1 Length = 171 Score = 212 bits (540), Expect = 2e-60 Identities = 99/163 (60%), Positives = 126/163 (77%) Query: 6 KGRVWKFGNNVDTDAILPARYLVYTKPEELAQFVMTGADPDFPKKVKPGDIIVGGKNFGC 65 +GRVWKFGN++DTDAI+PARYL P ELA M AD DF KKV+PGDIIV GKNFGC Sbjct: 4 RGRVWKFGNDIDTDAIIPARYLNTHDPRELALHCMEDADADFAKKVQPGDIIVAGKNFGC 63 Query: 66 GSSREHAPLGLKGAGISCVIAESFARIFYRNAINVGLPLIECKGISEKVNEGDELEVNLE 125 GSSREHAP+ +K AG+SCVIA SFARIFYRNA N+GLP++EC + E V +G+ L V+L Sbjct: 64 GSSREHAPIAIKAAGVSCVIAASFARIFYRNAFNMGLPILECADLVEVVEDGEILSVDLS 123 Query: 126 TGEIKNLTTGEVLKGQKLPEFMMEILEAGGLMPYLKKKMAESQ 168 +GEI +TG+ + Q +P FM E++EAGGL+PY+ +KM + + Sbjct: 124 SGEIIRESTGQTFRAQPVPPFMQELIEAGGLIPYVVQKMKKEE 166 Lambda K H 0.317 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 171 Length adjustment: 18 Effective length of query: 150 Effective length of database: 153 Effective search space: 22950 Effective search space used: 22950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
Align candidate WP_093393430.1 BM091_RS03265 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR02087 (3-isopropylmalate dehydratase, small subunit)
../bin/blast/fastacmd -i /tmp/list.16000.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.16000.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.