Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_093396386.1 BM091_RS13005 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_900114975.1:WP_093396386.1 Length = 250 Score = 194 bits (492), Expect = 2e-54 Identities = 105/248 (42%), Positives = 156/248 (62%), Gaps = 6/248 (2%) Query: 9 VLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAGTFEL 68 VL++ + K F GL+ LS V + +KRG+ + +IGPNGAGKTT FN+ITG Y P +G Sbjct: 7 VLRIEKLCKDFSGLEILSGVDLIVKRGERHAVIGPNGAGKTTLFNIITGKYKPSSGRIYY 66 Query: 69 AGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKGFK 128 G+ + +A+ GIAR+FQ +F +T LENV+ G +R+ GL + FR Sbjct: 67 RGRDVSGLSPDVLAQMGIARSFQITNVFQGLTVLENVLAG--VRSKRGLKYSFFRR---P 121 Query: 129 AEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAGM 188 E+ + +RA+++++ VG+ D +L+YG QR LEIA L+ DP LI LDEP AGM Sbjct: 122 VEQRELVERAKQIIEAVGLYDLMDRPVTSLAYGQQRALEIAITLSLDPHLILLDEPTAGM 181 Query: 189 NATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKNE 248 E + ELIDRI RT+++IEHD+ +V L D ++VL +G IA G+P +++ ++ Sbjct: 182 TREETKNVIELIDRITR-GRTLIIIEHDMDVVFSLADTISVLHHGVIIASGSPEKIRNDQ 240 Query: 249 KVIEAYLG 256 +V +AYLG Sbjct: 241 RVKDAYLG 248 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 250 Length adjustment: 24 Effective length of query: 236 Effective length of database: 226 Effective search space: 53336 Effective search space used: 53336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory