Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate WP_109966899.1 DK846_RS00150 acetolactate synthase small subunit
Query= BRENDA::P9WKJ3 (168 letters) >NCBI__GCF_003173355.1:WP_109966899.1 Length = 167 Score = 164 bits (416), Expect = 5e-46 Identities = 85/156 (54%), Positives = 112/156 (71%), Gaps = 1/156 (0%) Query: 6 HTLSVLVEDKPGVLARVAALFSRRGFNIESLAVGATECKDRSRMTIVVSAEDTPLEQITK 65 H SVLVED PGVL+RV LFSRRGFNIESLAVG E D SR+TIVVS D +EQ+ K Sbjct: 4 HIFSVLVEDSPGVLSRVTGLFSRRGFNIESLAVGTCEQPDTSRITIVVSGNDVQIEQVKK 63 Query: 66 QLNKLINVIKIVEQDDEHSVSRELALIKVQADAGS-RSQVIEAVNLFRANVIDVSPESLT 124 QLNKLI VIK+++ D V RELALIKV+A+ G RS +++ +FRA +IDV +SL Sbjct: 64 QLNKLIEVIKVLDITDLEHVERELALIKVKAEPGEVRSAIMQVAGIFRAKIIDVGTDSLM 123 Query: 125 VEATGNRGKLEALLRVLEPFGIREIAQSGMVSLSRG 160 +E TG+ K+ A+ ++ P+GI E+ ++G ++L RG Sbjct: 124 IEVTGDSSKIAAIEDLMSPYGIIEMVRTGKIALQRG 159 Lambda K H 0.315 0.131 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 97 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 167 Length adjustment: 18 Effective length of query: 150 Effective length of database: 149 Effective search space: 22350 Effective search space used: 22350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
Align candidate WP_109966899.1 DK846_RS00150 (acetolactate synthase small subunit)
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.24559.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.24559.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.