Align anthranilate synthase (subunit 2/2) (EC 4.1.3.27) (characterized)
to candidate WP_148231245.1 DESAC_RS12815 aminodeoxychorismate/anthranilate synthase component II
Query= BRENDA::P20576 (201 letters) >NCBI__GCF_000195295.1:WP_148231245.1 Length = 219 Score = 181 bits (458), Expect = 1e-50 Identities = 101/194 (52%), Positives = 129/194 (66%), Gaps = 7/194 (3%) Query: 2 LLMIDNYDSFTYNLVQYFGELKAEVKVVRNDELSVEQIEALAPERIVLSPGPCTPNEAGV 61 L++IDNYDSFTYNLVQ F E + EV V R+D++S+ Q+EAL P+ + +SPGP P +AG+ Sbjct: 3 LVIIDNYDSFTYNLVQLFFEFELEVMVFRHDQVSLNQLEALRPDWLCISPGPKAPQDAGL 62 Query: 62 SLAVIERFAGKLPLLGVCLGHQSIGQAFGGEVVRARQVMHGKTSPIHHKDLGVFAGLANP 121 S AVI F LP+LGVCLG Q+I + FGG A +HGK I H+ +G+F GL P Sbjct: 63 SKAVIAHFYKTLPILGVCLGMQAINEVFGGVTEPAPVPVHGKRHQIFHQGIGLFKGLPCP 122 Query: 122 LTVTRYHSLVVKRESLPECLEVTAWTQHADGSLDEIMGVRHKTLNVEGVQFHPESILTEQ 181 RYHSL+V+ S + L VTA++ ADG IMG+ H + + GVQFHPES LTE Sbjct: 123 FWAARYHSLMVRPAS--KELMVTAYS--ADG---VIMGLSHWSYPLHGVQFHPESFLTEY 175 Query: 182 GHELLANFLRQQGG 195 G EL ANFLR G Sbjct: 176 GRELAANFLRLAPG 189 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 219 Length adjustment: 21 Effective length of query: 180 Effective length of database: 198 Effective search space: 35640 Effective search space used: 35640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
Align candidate WP_148231245.1 DESAC_RS12815 (aminodeoxychorismate/anthranilate synthase component II)
to HMM TIGR00566 (glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase)
../bin/blast/fastacmd -i /tmp/list.591.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.591.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.