Align Anthranilate 1,2-dioxygenase (deaminating, decarboxylating) (EC 1.14.12.1) (characterized)
to candidate WP_176342956.1 BZY95_RS21645 aromatic-ring-hydroxylating dioxygenase subunit beta
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2739 (162 letters) >NCBI__GCF_002151265.1:WP_176342956.1 Length = 93 Score = 101 bits (252), Expect = 3e-27 Identities = 45/93 (48%), Positives = 63/93 (67%) Query: 1 MSALQYSIEQFLYRKAELCDQQDWDAYITLFDEQSEFHLPQWESEHVYTTDPKRSMSLIY 60 MS I+ FLYR+A L D ++WD ++T + + EF +P W+ + T DP +SLIY Sbjct: 1 MSLSYQEIQAFLYREARLLDDREWDEWLTCYSKDVEFWMPAWDDDDQLTRDPHSEISLIY 60 Query: 61 YSNRSGLEDRVFRLRTGKSAASTPMPRTLHQIS 93 Y +R GLEDRV+R++T +S ASTP PRT HQI+ Sbjct: 61 YPSREGLEDRVYRIKTERSGASTPEPRTTHQIT 93 Lambda K H 0.321 0.134 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 68 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 162 Length of database: 93 Length adjustment: 13 Effective length of query: 149 Effective length of database: 80 Effective search space: 11920 Effective search space used: 11920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 41 (20.4 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory