Align Probable alcohol dehydrogenase AdhA; EC 1.1.1.1 (uncharacterized)
to candidate WP_197539599.1 SUTH_RS14860 zinc-dependent alcohol dehydrogenase family protein
Query= curated2:P9WQC0 (346 letters) >NCBI__GCF_000828635.1:WP_197539599.1 Length = 333 Score = 273 bits (698), Expect = 5e-78 Identities = 156/337 (46%), Positives = 198/337 (58%), Gaps = 14/337 (4%) Query: 10 MSAWQVRRPGPMDTGPLERVTTRVPRPAPSELLVAVHACGVCRTDLHVTEGDLPVHRERV 69 M A + RPG PL V VPRP P LL+ V ACGVCRTDLH+ +G+LP V Sbjct: 5 MRAMMLDRPGT----PLRMVDLPVPRPGPGALLIEVEACGVCRTDLHLIDGELPNPLLPV 60 Query: 70 IPGHEVVGEVIEVGSAVGAAAGGEFDRGDRVGIAWLRHTCGVCKYCRRGSENLCPQSRYT 129 IPGHE+VG V +A+GA G F G RVG+ WL TCG C++C G ENLC +R+T Sbjct: 61 IPGHEIVGCV----AAIGADVHG-FRSGQRVGVPWLGWTCGTCRFCSSGRENLCDAARFT 115 Query: 130 GWDADGGYAEFTTVPAAFAHHLPSGYSDSELAPLLCAGIIGYRSLLRTELPPGGRLGLYG 189 G+ GGYAE+T A + LP ++LAPLLCAG+IGYR+L R+G+YG Sbjct: 116 GYQIHGGYAEYTVADARYCFPLPDDGDAAQLAPLLCAGLIGYRALRMA--GTSNRIGIYG 173 Query: 190 FGGSAHITAQVALAQGAEIHVMTR--GARARKLALQLGAASAQDAADRPPVPLDAAILFA 247 FG +AHI AQV Q E H TR ++ A +LGA A +PP LDAA++FA Sbjct: 174 FGAAAHIVAQVLKFQEREFHAFTRPDDTASQDFAHRLGAVWAGSTDQQPPALLDAALIFA 233 Query: 248 PVGDLVLPALEALDRGGILAIAGIHLTDIPDLNYQQHLFQERQIRSVTSNTRADARAFFD 307 P G LV AL L++GG + AGIH+++IP Y + L+ ER IRSV + TR D F + Sbjct: 234 PAGPLVPAALRHLEKGGSVVCAGIHMSEIPAFPY-EILWGERSIRSVANLTRRDGLEFLE 292 Query: 308 FAAQHHIEVTTPEYPLGQADRALGDLSAGRIAGAAVL 344 A + I PL QA+ AL L G+ GAAVL Sbjct: 293 LAPRIPIRTEVHPMPLAQANEALEQLRQGKFQGAAVL 329 Lambda K H 0.321 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 346 Length of database: 333 Length adjustment: 28 Effective length of query: 318 Effective length of database: 305 Effective search space: 96990 Effective search space used: 96990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory