Align Leucine/isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale)
to candidate WP_254914263.1 BZY95_RS21615 ABC transporter ATP-binding protein
Query= uniprot:G8ALJ0 (294 letters) >NCBI__GCF_002151265.1:WP_254914263.1 Length = 255 Score = 149 bits (376), Expect = 6e-41 Identities = 96/264 (36%), Positives = 141/264 (53%), Gaps = 16/264 (6%) Query: 11 LLTVEHLTMRFGGLVAVNDVSFSANNGEITAIIGPNGAGKTTLFNCITGFYTPTVGRLTL 70 +L V +LT F G AV+DV+ G I A+IGPNGAGKTT+FN +T F PT G + Sbjct: 5 ILEVRNLTKEFRGFTAVDDVNLQVQEGHIHALIGPNGAGKTTVFNLLTKFLPPTRGEILY 64 Query: 71 RHADGKEFLLERMPGYRISQKASVARTFQNIRLFGGMSVLENLIVAQHNKLIRASGFSIA 130 R GK + M I+ + + R+FQ +FG M+ +EN+ VA L R G S Sbjct: 65 R---GKP--ITGMKANEIA-RLGLVRSFQISAVFGHMTAMENVRVA----LQRPMGTSFH 114 Query: 131 GLLGLPSYTRTEREAVDLAKYWLDRVRLLEFADWEAGNLPYGAQRRLEIARAMCTEPVML 190 S A++L L+ V L E+AD +PYG +R LE+A + +P M+ Sbjct: 115 FWKSERSLDHLNDRAIEL----LEEVGLREYADVLTVEMPYGRKRALEVATTLAMDPTMM 170 Query: 191 CLDEPAAGLNPRESGELADLLTYIRDEHKIGVLLIEHDMSVVMTISDHVVVLDYGRKISD 250 LDEP G+ + + +L+ + VL++EH++SVV + D + VL G +++ Sbjct: 171 LLDEPTQGMGAEDVDRIVELVRRVAKGRT--VLMVEHNLSVVSRLCDRITVLARGAVLAE 228 Query: 251 GDPAFVKNDPAVIRAYLGEEEDEE 274 GD A V DP V AY+G + +EE Sbjct: 229 GDYATVSADPRVKEAYMGSDAEEE 252 Lambda K H 0.319 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 255 Length adjustment: 25 Effective length of query: 269 Effective length of database: 230 Effective search space: 61870 Effective search space used: 61870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory