Align 3-isopropylmalate dehydratase (EC 4.2.1.33) (characterized)
to candidate WP_340612390.1 ADEG_RS01155 3-isopropylmalate dehydratase small subunit
Query= BRENDA::Q58673 (168 letters) >NCBI__GCF_000024605.1:WP_340612390.1 Length = 162 Score = 196 bits (497), Expect = 2e-55 Identities = 89/160 (55%), Positives = 125/160 (78%), Gaps = 1/160 (0%) Query: 5 IKGRVWKFGNNVDTDAILPARYLVYTKPEELAQFVMTGADPDFPKKVKPGDIIVGGKNFG 64 ++GRV+KFG+++DTD I+PARYL T P ELA+ + ADP F ++V+PGD+IV G NFG Sbjct: 1 MEGRVFKFGDHIDTDLIIPARYLNTTDPAELAKHCLEDADPSFAREVRPGDVIVAGVNFG 60 Query: 65 CGSSREHAPLGLKGAGISCVIAESFARIFYRNAINVGLPLIECKGISEKVNEGDELEVNL 124 CGSSREHAPL +K AG++CV+A+SFARIFYRNA N+GLPL+EC + ++ G + V+L Sbjct: 61 CGSSREHAPLAIKAAGVACVVAQSFARIFYRNAFNIGLPLLECPD-APRIPAGSRVRVDL 119 Query: 125 ETGEIKNLTTGEVLKGQKLPEFMMEILEAGGLMPYLKKKM 164 ++G I+ L TGEV + +P FM EI+ AGGL+PY++K++ Sbjct: 120 QSGRIEVLDTGEVFTARPIPPFMQEIIAAGGLIPYVEKRL 159 Lambda K H 0.317 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 168 Length of database: 162 Length adjustment: 18 Effective length of query: 150 Effective length of database: 144 Effective search space: 21600 Effective search space used: 21600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
Align candidate WP_340612390.1 ADEG_RS01155 (3-isopropylmalate dehydratase small subunit)
to HMM TIGR02087 (3-isopropylmalate dehydratase, small subunit)
../bin/blast/fastacmd -i /tmp/list.16248.in -d ../tmp/orgsDef_201/orgs.faa -p T > /tmp/gapView.16248.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.