Align 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-hydroxysteroid dehydrogenase 10; 17-beta-HSD 10; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Scully protein; Type II HADH; EC 1.1.1.35; EC 1.1.1.51; EC 1.1.1.178 (characterized)
to candidate YP_001313934.1 Smed_5225 short-chain dehydrogenase/reductase SDR
Query= SwissProt::O18404 (255 letters) >NCBI__GCF_000017145.1:YP_001313934.1 Length = 257 Score = 110 bits (276), Expect = 2e-29 Identities = 89/254 (35%), Positives = 128/254 (50%), Gaps = 20/254 (7%) Query: 6 VSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKEL---GDKVVFVPVDVTSE 62 V+ VTG SG+GRA A LA++GA+V LAD + E A + + +DV+SE Sbjct: 9 VAAVTGAGSGIGRAIALGLAREGATVHLADRNADGLAETAALIRAEDGRAFTTELDVSSE 68 Query: 63 KDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNV 122 V ++ GRLD N AG K + LEDFQRV+ +N G F Sbjct: 69 VQVVGWVEQIGSISGRLDAAFNNAGITGPAKRIEH-----YPLEDFQRVVAVNLQGVFLG 123 Query: 123 IRLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIARDLST 182 ++ L+ + G IVNTASVAA G G +AY+ASK V G+T +A + + Sbjct: 124 MKHQIPLI------KRSGGGSIVNTASVAALTGPGGMSAYAASKHGVQGLTRVVAMENAA 177 Query: 183 QGIRICTIAPGLFNTPMLAALPEKVRTFLA---KSIPFPQRLGEPSEYAHLVQAIYEN-- 237 GIR+ IAPG TPM+AA ++ F A +IP +R G P E A + + Sbjct: 178 DGIRVNAIAPGWTETPMVAANSQQNPGFAALTQTAIP-AKRGGRPEEIAAAAIWLASDTA 236 Query: 238 PLLNGEVIRIDGAL 251 + G+++ +DG + Sbjct: 237 SYVTGQMLTVDGGM 250 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 257 Length adjustment: 24 Effective length of query: 231 Effective length of database: 233 Effective search space: 53823 Effective search space used: 53823 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory