Align ring 1,2-phenylacetyl-CoA epoxidase PaaE subunit (EC 1.14.13.149) (characterized)
to candidate YP_001326176.1 Smed_0484 ferredoxin
Query= metacyc::MONOMER-15950 (357 letters) >NCBI__GCF_000017145.1:YP_001326176.1 Length = 364 Score = 145 bits (366), Expect = 2e-39 Identities = 113/355 (31%), Positives = 169/355 (47%), Gaps = 27/355 (7%) Query: 5 HSLTIKEVRPETRDAVSIAF--DVPAELADSFRFTQGQHLVMRTQLDGEEVRRSYSIC-T 61 H L V ET D ++ F D PA FR+ GQ + + ++ E V R+Y++ T Sbjct: 21 HMLQCVSVATETADVMTFTFRSDKPAW----FRYLPGQFVTLELPVEEEPVMRTYTLSST 76 Query: 62 GVNDGELRVAIKRVAGGRFSAYANESLKAGQRLEVMPPSGHFHVELDAARHGN--YLAVA 119 + V +K G + + ++LK G L+ P G F RH YL ++ Sbjct: 77 PSRPLSIAVTVKAQPGSVGTRWMFDNLKPGMVLKAFGPLGDFSF----VRHPGERYLFIS 132 Query: 120 AGSGITPILSIIKTTLETEPHSRVTLLYGNRSSASTLFREQLEDLKNRYLQRLNLIFLFS 179 AGSGITP++S+ + + P S VT + R LF+ +LE L R + +LNL FL Sbjct: 133 AGSGITPMISMTRWMADCAPESNVTFISCARRPDDLLFKYELEVLA-RQMPQLNLGFLVE 191 Query: 180 REQQDVDLYN--GRIDADKCGQLFSRWIDVKALDAAFICGPQAMTETVRDQLKANGMAAE 237 + + GR+DA K L +++ F CGP+ VRD L+ G E Sbjct: 192 GHEARHGWHGLRGRLDATKLPLLAPDFME----RTVFCCGPEPFMAGVRDMLEMAGFQME 247 Query: 238 RIHFELF--AAAGSAQKREARESAAQDSSV--SQITVISDGRELSFELPRNSQSILDAGN 293 R H E F A A SA RE A D+ S++T G+E LP ++L Sbjct: 248 RYHQESFQPATAPSAGDLAIREGPAADTEAGASRVTFTMSGKEAP-ALP--GHTVLQTAR 304 Query: 294 AQGAELPYSCKAGVCSTCKCKVVEGEVEMDSNFALEDYEVAAGYVLSCQTFPISD 348 A G + +C+ G+C TC+ + G+VEM+ N + D E+ GY+L+C + PI D Sbjct: 305 ANGVRIGAACEGGICGTCRVMKIAGDVEMNHNGGILDDEIEEGYILACCSRPIGD 359 Lambda K H 0.319 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 357 Length of database: 364 Length adjustment: 29 Effective length of query: 328 Effective length of database: 335 Effective search space: 109880 Effective search space used: 109880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory