Align RhaS, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate YP_002823359.1 NGR_b11530 ribose ABC transporter periplasmic protein
Query= TCDB::Q7BSH5 (331 letters) >NCBI__GCF_000018545.1:YP_002823359.1 Length = 330 Score = 131 bits (330), Expect = 2e-35 Identities = 99/296 (33%), Positives = 154/296 (52%), Gaps = 10/296 (3%) Query: 3 LAKTLALGVALAVAMMAGTASAKDIKIGLVVKSLGNGFFDAANKGAQEAAKELGGVEVIY 62 LA LA ++LA A A K+G+VVK G +F+A G +E ++LG ++ Sbjct: 6 LAAALAASLSLAGAFSVAAQDAP--KVGVVVKIGGIPWFNAMEVGIKERGQKLG-LDAFM 62 Query: 63 TGPTSTTAEGQIEVINSLIAQGVDAIAVSANDPDALVPALKKATQRGIKVISWDSGVAPE 122 GPTS Q+ I LIAQGV I V ND L P L KA ++GI VI+ +S + + Sbjct: 63 VGPTSADPALQVRAIEDLIAQGVKVIGVVPNDAKVLEPVLTKAKEKGIIVITHESP-SQK 121 Query: 123 GRILQLNPSSNELIGKMCLTLAKDHLEGGKGDFAILSATTTSTNQNIWIDQMKKQLK-DF 181 G +S++ G+ L + + GGKG++A+ + T N W D +K ++ Sbjct: 122 GADWDFELASSQGFGEAHGKLLAEKM-GGKGEYAVFVGSLTVPLHNAWADAAIAYIKKNY 180 Query: 182 PGLNLVTTVYG--DDLSDKSYREAEGLLKSNPNVKVIVAPTTVGVLAASKVVEDKGLVGK 239 P + LV YG +D+ DKS A L+ ++PN+K +A + G + A + +E++ VG+ Sbjct: 181 PEMTLVGERYGVAEDV-DKSRSTALDLISAHPNLKGFLAFGSQGPIGAGRAIEERRKVGE 239 Query: 240 VYVTGLGLPSEMAGAIKSGATKEFAIWNPIDLGYSATQIAYRLVKGETDGKPGSEI 295 ++V G P + +KS A +WNP G +A +L+KGE + K G EI Sbjct: 240 IFVLGPFSPGQGQKLVKSDAISGGFMWNPKQAGEVFVTMADKLLKGE-EVKDGEEI 294 Lambda K H 0.313 0.131 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 330 Length adjustment: 28 Effective length of query: 303 Effective length of database: 302 Effective search space: 91506 Effective search space used: 91506 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory