Align L-lactate dehydrogenase; EC 1.1.1.27 (uncharacterized)
to candidate YP_004134398.1 Mesci_6229 malate/l-lactate dehydrogenase
Query= curated2:Q07251 (349 letters) >NCBI__GCF_000185905.1:YP_004134398.1 Length = 343 Score = 99.8 bits (247), Expect = 9e-26 Identities = 69/226 (30%), Positives = 101/226 (44%), Gaps = 8/226 (3%) Query: 26 ADDVAEHLVESDRCGYISHGLSILPNYRTALDGHSVNPQGRAKCV-LDQGTLMVFDGDGG 84 A + +V ++R SHG+ + + VNP + + D ++ D GG Sbjct: 29 ASAITRVIVAAERDACKSHGVYRVEGALRTIKAGKVNPNAEPELLPQDAPAIIKVDAKGG 88 Query: 85 FGQHVGKSVMQAAIERVRQHGHCIVTLRRSHHLGRMGHYGEMAAAAGFVLLSFTNVINRA 144 F + + +ER R G + + + H + E + AG L+ + Sbjct: 89 FANPAFELGLPVLVERARSCGIAALAINDAVHFSALWVEVEALSQAGLAGLA---MCPSY 145 Query: 145 PVVAPFGGRVARLTTNPLCFAGPMPNGRPPLVVDIATSAIAINKARVLAEKGEPAPEGSI 204 VAP GG L TNP F P +PP V D ATS A + + G+ PEG Sbjct: 146 ATVAPTGGNGPLLGTNPFAFGWPREE-QPPYVFDFATSVAARGEIELHRRTGKSLPEGWA 204 Query: 205 IGADGNPTTDASTMFGEHPGALLPFGGHKGYALGVVAELLAGVLSG 250 + +DG PTTD GA+LPFGGHKG A+ + ELLAG++ G Sbjct: 205 MDSDGRPTTDPEAALS---GAMLPFGGHKGSAIATMIELLAGIMIG 247 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 349 Length of database: 343 Length adjustment: 29 Effective length of query: 320 Effective length of database: 314 Effective search space: 100480 Effective search space used: 100480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory