Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate YP_004139780.1 Mesci_0558 inner-membrane translocator
Query= TCDB::Q8DQH9 (318 letters) >NCBI__GCF_000185905.1:YP_004139780.1 Length = 349 Score = 187 bits (476), Expect = 2e-52 Identities = 112/336 (33%), Positives = 182/336 (54%), Gaps = 37/336 (11%) Query: 1 MKENLKVNILWLLLLLAGYSLISVLVSVG---VLNLFYVQILQQIGINIILAVGLNLIVG 57 M ++ +L L+ ++AG +V+ G VL+ ++V+I+ I +N IL + L+L G Sbjct: 1 MSREARITLLVLVAVVAG-----AVVAFGAPHVLSDYFVRIILLIALNAILVLALSLSNG 55 Query: 58 FSGQFSLGHAGFMAIGAYAAAIIGSKSPTYGA---------------FFGAMLVGALLSG 102 F+G FSLGH GF+ GAY + I+ A F A LV +L+ Sbjct: 56 FTGVFSLGHVGFIGAGAYISGILSIPVQQKMALLPHLPGFLHAFSLPFLPATLVAGVLTA 115 Query: 103 AVALLVGIPTLRLKGDYLAVATLGVSEIIRIFIINGGSLTNGAAGILGIPNFTTWQMVYF 162 +A++VG P +RL G +++VAT+G I+ + +IN T GA G+P TT V Sbjct: 116 LLAVVVGYPLMRLSGYFVSVATMGFLIIVNVVLINASDFTRGARTFTGVPLETTLPWVMG 175 Query: 163 FVVITTIATLNFLRSPIGRSTLSVREDEIAAESVGVNTTKIKIIAFVFGAITASIAGSLQ 222 ++ IT + SP GR+ +VR+D IAA +VG+ + ++IAFV GA + + GSL Sbjct: 176 WLAITVFVLARLVYSPFGRAMKAVRDDTIAASAVGIGVLRTRLIAFVIGAFFSGVGGSLY 235 Query: 223 AGFIGSVVPKDYTFINSINVLIIVVFGGLGSITGAIVSAIVLGILNMLLQDVA------- 275 A ++GS P + F +++++ ++V GG+GS+TGA+V I + +L+ +L+ V Sbjct: 236 AHYLGSFSPNTFYFALTMSLITMLVLGGMGSLTGAVVGVICVSLLSEVLRSVERGFTIGD 295 Query: 276 -------SVRMIIYALALVLVMIFRPGGLLGTWELS 304 I+ +LVMIFRP G++G EL+ Sbjct: 296 FAVPALFGASQIVLGFIFILVMIFRPKGIMGDRELT 331 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 349 Length adjustment: 28 Effective length of query: 290 Effective length of database: 321 Effective search space: 93090 Effective search space used: 93090 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory