Align Ketoglutarate semialdehyde dehydrogenase (EC 1.2.1.26) (characterized)
to candidate YP_004139899.1 Mesci_0678 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase
Query= reanno::Smeli:SM_b20891 (477 letters) >NCBI__GCF_000185905.1:YP_004139899.1 Length = 505 Score = 313 bits (802), Expect = 9e-90 Identities = 192/480 (40%), Positives = 259/480 (53%), Gaps = 38/480 (7%) Query: 13 VGGDGVANINPSNTDDV-------VGEYARASAEDAKAAIAAAKAAFPAWSRSGILERHA 65 +GG+ V ++ + + + + AR A D A AAKAAFPAW+ R Sbjct: 27 IGGEAVPALDGATFETLSPVDLKPLASVARGGAADIDRAAKAAKAAFPAWAAMPGEARKK 86 Query: 66 ILKKTADEILARKDELGRLLSREEGKTLAEGIGETVRAGQIFEFFA--------GETLRL 117 +L K AD I AR +E+ + + G+ L +R + F FFA GETLR Sbjct: 87 LLHKIADAIEARAEEIAFVECMDTGQALKFMAKAALRGAENFRFFADRAPEARDGETLRT 146 Query: 118 AGEVVPSVRPGIGVEITREPAGVVGIITPWNFPIAIPAWKLAPALCYGNTIVFKPAELVP 177 G+V + TR P G VGIITPWN P + WK+APAL G T+V KPAE P Sbjct: 147 TGQVNMT---------TRVPIGPVGIITPWNTPFMLSTWKIAPALAAGCTVVHKPAEFSP 197 Query: 178 GCSWAIVDILHRAGLPKGVLNLVMGKGSVVGQAMLDSPDVQAITFTGSTATGKRVAVASV 237 + +V+I AGLPKGV NLV G G G+A+ + PD++AI F G + TG + Sbjct: 198 LTARLLVEIAEEAGLPKGVWNLVNGLGEDAGKALTEHPDIRAIGFVGESRTGSMIMKQGA 257 Query: 238 EHNRKYQLEMGGKNPFVVLDDADLSVAVEAAVNSAFFSTGQRCTASSRIIVTEGIHDRFV 297 ++ E+GGKNP +V DADL A +AAV + G+RCT+SSR++V I++ F Sbjct: 258 GTLKRVHFELGGKNPVIVFADADLERAADAAVFMIYSLNGERCTSSSRLLVEASIYESFT 317 Query: 298 AAMGERIKGLVVDDALKPGTHIGPVVDQSQLNQDTDYIAIGKQEGAKLAFGGEVISRDTP 357 A + ER K +VV L P T +GP++ + YI IG+ EGA LA GG + Sbjct: 318 AKVAERAKRIVVGHPLDPKTVVGPLIHPVHEKKVLSYIDIGRSEGATLAVGGGKVDGPGD 377 Query: 358 GFYLQPALFTEATNEMRISREEIFGPVAAVIRVKDYDEALAVANDTPFGLSSGIATTSLK 417 G Y+ P LFT TN MRI++EEIFGPV + I D EALA+ANDT +GL+ + T+ + Sbjct: 378 GCYVGPTLFTNVTNGMRIAQEEIFGPVLSAIPFNDEAEALALANDTQYGLTGYLWTSDVT 437 Query: 418 HATHFKRNAEAGMVMVN------LPTAGVDFHVPFGGRKASSYGPREQGKYAAEFYTNVK 471 A F EAGM+ VN LPT PFGG K S G R+ G ++ +FY K Sbjct: 438 RAFRFTDALEAGMIWVNSENVRHLPT-------PFGGVKNSGIG-RDGGDHSFDFYMETK 489 Lambda K H 0.317 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 599 Number of extensions: 27 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 505 Length adjustment: 34 Effective length of query: 443 Effective length of database: 471 Effective search space: 208653 Effective search space used: 208653 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory