Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate YP_004140673.1 Mesci_1464 transketolase
Query= metacyc::MONOMER-11684 (327 letters) >NCBI__GCF_000185905.1:YP_004140673.1 Length = 332 Score = 298 bits (762), Expect = 2e-85 Identities = 156/324 (48%), Positives = 216/324 (66%), Gaps = 3/324 (0%) Query: 4 MSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAESAI 63 +SY AI AM M+ D RVF++GED+G GG F+ T L E++G +RV+DTP++E Sbjct: 8 LSYAQAIQEAMAIAMDMDERVFLMGEDIGVYGGAFQVTGDLVERYGADRVIDTPISELGG 67 Query: 64 AGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYGGGV 123 AGV +GAA+ GMRPI E QF+DF A+ QI+++AAK+R+ + S P+V+R P G G Sbjct: 68 AGVAVGAALTGMRPIFEFQFSDFATLAMEQIVNQAAKMRFMLGGEVSVPVVMRFPAGSGT 127 Query: 124 HGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLIKGE 183 A HSQS+EA + PGLK++ P+TPYDAKG+L AAV D DPV+ FEHK Y++ KG Sbjct: 128 GAAAQHSQSLEAWLGHVPGLKVIQPATPYDAKGMLLAAVADPDPVMIFEHKLLYKM-KGP 186 Query: 184 VPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVYPLD 243 VP Y +PIGKAD++REG D+T++ + V AL AA LE +GI VVDLRT+ P+D Sbjct: 187 VPEGYYTVPIGKADIRREGRDLTIVATSIMVQKALDAAAVLESEGIDVEVVDLRTIRPMD 246 Query: 244 KEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFD-LDAPIKRLAGPDIPAMPY 302 K+ +I++ KT ++L V E K I +EV+A+I+E FD LDAPI RL G + P +PY Sbjct: 247 KQTVIDSVKKTSRLLCVYEAVKTLGIGAEVSAMIAESEAFDYLDAPIVRLGGAETP-IPY 305 Query: 303 APTMEKYFMVNPDKVEAAMRELAE 326 P +EK + + A R+L + Sbjct: 306 NPELEKVTVPQIPDIITAARDLVK 329 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 332 Length adjustment: 28 Effective length of query: 299 Effective length of database: 304 Effective search space: 90896 Effective search space used: 90896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory