Align Maleylacetoacetate isomerase; MAAI; EC 5.2.1.2 (uncharacterized)
to candidate YP_004143097.1 Mesci_3931 glutathione S-transferase
Query= curated2:P57109 (212 letters) >NCBI__GCF_000185905.1:YP_004143097.1 Length = 203 Score = 69.3 bits (168), Expect = 5e-17 Identities = 54/177 (30%), Positives = 88/177 (49%), Gaps = 26/177 (14%) Query: 1 MKLYTYYRSTSSYRVRIALALKGLDYQSLPVNLIRDGGEHRQPAYLALNPQGRVPALQVD 60 MKL+ R+ + RVR+ LA KG++ +P+++ EHRQ A + NP R+P L++D Sbjct: 1 MKLFDGGRAPNPRRVRVFLAEKGIEVAQVPIDM--GALEHRQQAVSSRNPLQRLPVLELD 58 Query: 61 EGELLIQSPAIIEYLEERYPQPALLSSDPLRRA-----RERGVAALVGC------DIHPL 109 +G ++ +S AI Y EE +P+PAL L +A + R L+ C IHP Sbjct: 59 DGTVITESVAICRYFEELHPEPALFGRGALGKAQVEMWQRRMEFNLLSCVTQAFRHIHP- 117 Query: 110 HNASVLNLLRQWGHDEEQVRQWIGHWVGQGLAAVEQLIGDQG---WCFGDRPGLADV 163 +++W + QV W + +A + L G+ G + GD +AD+ Sbjct: 118 -------AMKEW--EIPQVPDWGEANKPKAVAFLRLLDGELGSREFIAGDSYSIADI 165 Score = 22.3 bits (46), Expect = 0.007 Identities = 13/39 (33%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Query: 167 PQLYAAERFGVA-LDAWPRIRRVADLAAAHPAFRQAHPA 204 P L+ G A ++ W R L+ AFR HPA Sbjct: 80 PALFGRGALGKAQVEMWQRRMEFNLLSCVTQAFRHIHPA 118 Lambda K H 0.321 0.138 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 136 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 212 Length of database: 203 Length adjustment: 21 Effective length of query: 191 Effective length of database: 182 Effective search space: 34762 Effective search space used: 34762 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory