Align Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate YP_004143121.1 Mesci_3956 triosephosphate isomerase
Query= SwissProt::Q8L1Z5 (254 letters) >NCBI__GCF_000185905.1:YP_004143121.1 Length = 255 Score = 304 bits (779), Expect = 1e-87 Identities = 154/254 (60%), Positives = 185/254 (72%) Query: 1 MSPNIRPFIAGNWKMNGTGESLGELRAIAAGISSDLGRLFEALICVPATLLSRAFDILGG 60 M+P IRP +AGNWKMNGT SL ELR I G S L EAL+CVPATLL+ A +IL Sbjct: 1 MTPGIRPLVAGNWKMNGTSASLNELRMIGNGFMSGLDAETEALVCVPATLLAHAAEILSR 60 Query: 61 ENILLGGQNCHFDDYGPYTGDISAFMLKEAGASHVIIGHSERRTVYQESDAIVRAKVQAA 120 + GG++CH + G YTG ISA ML++AGASHVI+GHSE R E DA V+AK AA Sbjct: 61 TPVHAGGEDCHTKESGAYTGCISAEMLRDAGASHVIVGHSECREQRGEDDATVQAKASAA 120 Query: 121 WRAGLVALICVGETLEERKSNKVLDVLTRQLEGSLPDGATAENIIIAYEPVWAVGTGNTA 180 WRAGLVA+ICVGET E+R++ LDVL+RQ+EGS+P AT N IIAYEPVWA+GTG T Sbjct: 121 WRAGLVAIICVGETHEQREAGATLDVLSRQVEGSVPPSATPSNTIIAYEPVWAIGTGLTP 180 Query: 181 TSADVAEVHAFIHHKMHSRFGDEGAKIRLLYGGSVKPSNAFELLSTAHVNGALIGGASLK 240 T+ADVA HA I K+ + G AK+R+LYGGSVKPSNA ELL +V+GAL+GGASLK Sbjct: 181 TAADVAAAHAHIREKLSEKLGGVAAKVRILYGGSVKPSNAVELLGVRNVDGALVGGASLK 240 Query: 241 AIDFLTICDVYRKL 254 A DFL I + YR + Sbjct: 241 AADFLGIAEAYRNI 254 Lambda K H 0.320 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 255 Length adjustment: 24 Effective length of query: 230 Effective length of database: 231 Effective search space: 53130 Effective search space used: 53130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate YP_004143121.1 Mesci_3956 (triosephosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00419.hmm # target sequence database: /tmp/gapView.4213.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-51 161.9 2.2 1.3e-51 161.6 2.2 1.0 1 lcl|NCBI__GCF_000185905.1:YP_004143121.1 Mesci_3956 triosephosphate isome Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000185905.1:YP_004143121.1 Mesci_3956 triosephosphate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 161.6 2.2 1.3e-51 1.3e-51 1 227 [. 8 241 .. 8 242 .. 0.89 Alignments for each domain: == domain 1 score: 161.6 bits; conditional E-value: 1.3e-51 TIGR00419 1 lviinfKlnesvgkvelevaklae.evas.eagvevavappfvdldvvkdeve.seiqvaAqnvdavks 66 lv +n+K+n++ + ++ + + + +++ a+ e v +p l +++ ++ + ++ + ++++++s lcl|NCBI__GCF_000185905.1:YP_004143121.1 8 LVAGNWKMNGTSASLNE-LRMIGNgFMSGlDAETEALVCVPATLLAHAAEILSrTPVHAGGEDCHTKES 75 799*******9877665.555655255552345566788888888888888874566666799****** PP TIGR00419 67 GaftGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaarti 135 Ga+tG isAeml+d+Ga +v++gHsE R e d +++k + + gl +++Cvget e+rea+ t+ lcl|NCBI__GCF_000185905.1:YP_004143121.1 76 GAYTGCISAEMLRDAGASHVIVGHSECREQRGEDDATVQAKASAAWRAGLVAIICVGETHEQREAGATL 144 ********************************************************************* PP TIGR00419 136 nnvattaaaaA.....lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkkvskevaesvrvlyGa 199 +++ ++ + ++ ++A+EPv++iGtG + + A+ + ++ +r+ l++ va +vr+lyG+ lcl|NCBI__GCF_000185905.1:YP_004143121.1 145 DVLSRQVEGSVppsatPSNTIIAYEPVWAIGTGLTPTAADVAAAHAHIREKLSEKLGGVAAKVRILYGG 213 ***9997754445545899************************************************** PP TIGR00419 200 svtaaedaelaaqldvdGvLlasavlka 227 sv+ ++++el +vdG+L+++a+lka lcl|NCBI__GCF_000185905.1:YP_004143121.1 214 SVKPSNAVELLGVRNVDGALVGGASLKA 241 ***************************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (255 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.34 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory