Align methylmalonyl-CoA mutase (subunit 1/2) (EC 5.4.99.2) (characterized)
to candidate YP_004144070.1 Mesci_4914 methylmalonyl-CoA mutase large subunit
Query= BRENDA::A4YIE3 (155 letters) >NCBI__GCF_000185905.1:YP_004144070.1 Length = 707 Score = 115 bits (289), Expect = 1e-30 Identities = 54/120 (45%), Positives = 80/120 (66%) Query: 22 KVVVAKLGLDGHDRGAKVIARALKDAGMEVVYTGLRQTPEQIVRTAIQEDADVIGISILS 81 +++VAK+G DGHDRG KVIA A D G +V + QTP++I R A+ +D ++G S L+ Sbjct: 580 RILVAKMGQDGHDRGQKVIATAFADLGFDVTVGAMFQTPDEIARLAVAQDVHIVGASSLA 639 Query: 82 GAHLELMPKIVEALKKAGLDDVGLVLGGVIPPEDIPKLKAMGVDDVFLPGTSLKEIAQRV 141 HL L+P++ +ALKK G D+ +V GGVIPP+D ++ G ++F PGT + E A R+ Sbjct: 640 AGHLTLIPELRDALKKLGRGDMLIVAGGVIPPQDYDAVRQAGAAEIFPPGTVIPEAADRL 699 Lambda K H 0.319 0.140 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 155 Length of database: 707 Length adjustment: 28 Effective length of query: 127 Effective length of database: 679 Effective search space: 86233 Effective search space used: 86233 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory