Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate YP_004144467.1 Mesci_5319 triosephosphate isomerase
Query= BRENDA::Q7X216 (265 letters) >NCBI__GCF_000185905.1:YP_004144467.1 Length = 255 Score = 218 bits (555), Expect = 1e-61 Identities = 121/257 (47%), Positives = 159/257 (61%), Gaps = 8/257 (3%) Query: 2 MTPIWLGTSWKMNKPLSQAMAWCETLAARMPEGCHPAIQPFVIPSFTAIQPVSHFLQTHQ 61 M P W+GTSWKMNK L++A+ + + LAA +P G AIQPFVIP FTA + V L + Sbjct: 1 MAPYWVGTSWKMNKTLAEALLFADALAAFVP-GFDQAIQPFVIPPFTAARQVKAALANTR 59 Query: 62 LPLLTGAQNMHEADQGAWTGEISAAMLAETGATLVELGHSERRAAFNESDAAINRKVHSA 121 + + GAQNMH AD GAWTGEIS ML + G ++ELGHSERR F E+DA + K +A Sbjct: 60 VKV--GAQNMHWADAGAWTGEISPVMLKDCGLDVIELGHSERREHFGETDATVGLKTAAA 117 Query: 122 LGHGLRPLICIGDSAEEKRWQVSRESVVRQMKIALYGLS-HQQALRTLIAYEPVWAIGEH 180 + HG PLIC+G++ +E+ + + Q+ AL LS Q L AYEPVWAIGE Sbjct: 118 VRHGFVPLICVGETLDERESGRAEAVLTAQVLGALQELSGDQPKAEILFAYEPVWAIGEK 177 Query: 181 GTPASPQEAGVIHQALRQALCERFGHETGTRIPLLYGGXVTLQNAVELLRQQEINGLFIG 240 G PAS A ++Q +R P+LYGG V NA EL+ Q I+GLFIG Sbjct: 178 GIPASADYADKQQALIKQVAADRL----PAAPPVLYGGSVNPGNAAELIGQPHIDGLFIG 233 Query: 241 RAAWDAQGYCDIVQRVT 257 R+AW A+GY DI+++ + Sbjct: 234 RSAWQAEGYIDILKKAS 250 Lambda K H 0.321 0.133 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 217 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 255 Length adjustment: 24 Effective length of query: 241 Effective length of database: 231 Effective search space: 55671 Effective search space used: 55671 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory