Align RhaP, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate YP_004145002.1 Mesci_5945 inner-membrane translocator
Query= TCDB::Q7BSH3 (333 letters) >NCBI__GCF_000185905.1:YP_004145002.1 Length = 324 Score = 409 bits (1051), Expect = e-119 Identities = 204/320 (63%), Positives = 250/320 (78%) Query: 1 MARLIRKRETLLFLIIVVMIVVFSTRAADFATPGNLAGIFNDTSILIILALAQMTVILTK 60 M ++ RE L I+V+I + STR FA P NL +FNDTSIL+ILAL QM VILT+ Sbjct: 1 MKAFLKYREIWLAAAIIVLIGLISTRFPAFADPANLRQVFNDTSILMILALGQMVVILTR 60 Query: 61 SIDLSVAANLAFTGMAIAMMNAAHPDLPLVVLILMAVVIGACLGAINGFLVWALEIPPIV 120 SIDLS+A+NL FTGM +AM+NAAHP +P+ +LI++A+V+G LGAING LVW L IP IV Sbjct: 61 SIDLSMASNLCFTGMVVAMLNAAHPAIPIPLLIVIALVVGLVLGAINGLLVWRLNIPSIV 120 Query: 121 VTLGTLTIYRGMAFVLSGGAWVNAHQMTPIFLSVPRTPVLGLPVLSWVGIIIVILMYVLL 180 VTLGTLTIYRG FVLSGGAWVNA +M+P F+ R LG+PVLSW+ I+++ L +V++ Sbjct: 121 VTLGTLTIYRGATFVLSGGAWVNADKMSPEFIGFQRAAFLGIPVLSWIAILVIALFFVVM 180 Query: 181 RYTQFGRSAYATGGNPTAAVYAGIDTGWTKFLAFVLSGALAGLASYLWVSRYAVAYVDIA 240 T GRS YA G NPTA+VYAGID G TKF+ F +SG + GL+ YLW+SRY +A V++A Sbjct: 181 TRTALGRSIYAIGVNPTASVYAGIDVGRTKFIVFCISGMIGGLSGYLWISRYVIASVEVA 240 Query: 241 NGFELDSVAACVIGGISIAGGVGSVAGTVLGALFLGVIKNALPVIGISPFTQMAISGTVI 300 NG+EL+ +AACVIGGISIAGG+GSV G VLGALFLG+I NALPVI ISPF QMAISG+ I Sbjct: 241 NGYELNIIAACVIGGISIAGGIGSVGGAVLGALFLGIISNALPVINISPFWQMAISGSAI 300 Query: 301 ILAVAFNARRERNRGRIILR 320 ILAV NAR ER +GRIILR Sbjct: 301 ILAVVLNARGERQQGRIILR 320 Lambda K H 0.328 0.141 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 324 Length adjustment: 28 Effective length of query: 305 Effective length of database: 296 Effective search space: 90280 Effective search space used: 90280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory