Align Maleylacetoacetate isomerase; MAAI; EC 5.2.1.2 (uncharacterized)
to candidate YP_425114.1 Rru_A0022 glutathione S-transferase-like protein
Query= curated2:P57109 (212 letters) >NCBI__GCF_000013085.1:YP_425114.1 Length = 222 Score = 71.2 bits (173), Expect = 1e-17 Identities = 62/205 (30%), Positives = 95/205 (46%), Gaps = 13/205 (6%) Query: 2 KLYTYYRSTSSYRVRIALALKGLDYQSLPVNLIRDGGEHRQPAYLALNPQGRVPALQVDE 61 +LY + S ++ +VR+ALA K LDY++ + + R ++LA+NP+G VP L + Sbjct: 3 RLYHHGLSPAARKVRVALAEKRLDYEA-----VIEETWIRNESFLAMNPEGEVPVLVEAD 57 Query: 62 GELLIQSPAIIEYLEERYPQPALLSSDPLRRARERGVAALVGCDIH-----PLHNASVLN 116 G + AI EYLEE YP+P+LL RA R + A + PL +L Sbjct: 58 GLTITDGWAICEYLEEVYPEPSLLGGPAAMRAEVRRLVAWFDRKFNREVTEPLVREKLLK 117 Query: 117 LLRQWG-HDEEQVRQWIGHWVGQGLAAVEQLIGDQGWCFGDRPGLADVYLVPQLYAAERF 175 + G D Q+R + V L + LI + W GD AD+ L + Sbjct: 118 RVISGGAPDSRQIRAGRAN-VHTHLRYISWLIDRRRWLAGDMLTYADITAACHLSLIDYA 176 Query: 176 G-VALDAWPRIRRVADLAAAHPAFR 199 G V + P+ + L + P+FR Sbjct: 177 GDVPWEDHPQAKEWYALVKSRPSFR 201 Lambda K H 0.321 0.138 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 212 Length of database: 222 Length adjustment: 22 Effective length of query: 190 Effective length of database: 200 Effective search space: 38000 Effective search space used: 38000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory