GapMind for catabolism of small carbon sources

 

Protein YP_426425.1 in Rhodospirillum rubrum ATCC 11170

Annotation: NCBI__GCF_000013085.1:YP_426425.1

Length: 527 amino acids

Source: GCF_000013085.1 in NCBI

Candidate for 21 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
2'-deoxyinosine catabolism H281DRAFT_01113 hi deoxynucleoside transporter, ATPase component (characterized) 64% 99% 632.9 Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR 41% 353.6
D-fructose catabolism frcA med ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale) 42% 92% 335.1 deoxynucleoside transporter, ATPase component 64% 632.9
sucrose catabolism frcA med ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale) 42% 92% 335.1 deoxynucleoside transporter, ATPase component 64% 632.9
D-cellobiose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 39% 97% 342 deoxynucleoside transporter, ATPase component 64% 632.9
D-glucose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 39% 97% 342 deoxynucleoside transporter, ATPase component 64% 632.9
lactose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 39% 97% 342 deoxynucleoside transporter, ATPase component 64% 632.9
D-maltose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 39% 97% 342 deoxynucleoside transporter, ATPase component 64% 632.9
sucrose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 39% 97% 342 deoxynucleoside transporter, ATPase component 64% 632.9
trehalose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 39% 97% 342 deoxynucleoside transporter, ATPase component 64% 632.9
D-xylose catabolism xylG lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 39% 97% 342 deoxynucleoside transporter, ATPase component 64% 632.9
D-ribose catabolism rbsA lo Ribose import ATP-binding protein RbsA 2, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose (characterized) 38% 96% 335.5 deoxynucleoside transporter, ATPase component 64% 632.9
D-mannose catabolism HSERO_RS03640 lo Ribose import ATP-binding protein RbsA; EC 7.5.2.7 (characterized, see rationale) 39% 97% 334.7 deoxynucleoside transporter, ATPase component 64% 632.9
myo-inositol catabolism PS417_11890 lo m-Inositol ABC transporter, ATPase component (itaA) (characterized) 39% 92% 334.7 deoxynucleoside transporter, ATPase component 64% 632.9
L-arabinose catabolism araVsh lo ABC transporter related (characterized, see rationale) 40% 97% 327.8 deoxynucleoside transporter, ATPase component 64% 632.9
D-galactose catabolism mglA lo Galactose/methyl galactoside import ATP-binding protein MglA aka B2149, component of Galactose/glucose (methyl galactoside) porter (characterized) 34% 98% 300.4 deoxynucleoside transporter, ATPase component 64% 632.9
L-arabinose catabolism araG lo L-arabinose ABC transporter, ATP-binding protein AraG; EC 3.6.3.17 (characterized) 36% 98% 291.2 deoxynucleoside transporter, ATPase component 64% 632.9
D-galactose catabolism BPHYT_RS16930 lo Arabinose import ATP-binding protein AraG; EC 7.5.2.12 (characterized, see rationale) 35% 99% 286.2 deoxynucleoside transporter, ATPase component 64% 632.9
2'-deoxyinosine catabolism nupA lo Purine/cytidine ABC transporter ATP-binding protein, component of General nucleoside uptake porter, NupABC/BmpA (transports all common nucleosides as well as 5-fluorocytidine, inosine, deoxyuridine and xanthosine) (Martinussen et al., 2010) (Most similar to 3.A.1.2.12). NupA is 506aas with two ABC (C) domains. NupB has 8 predicted TMSs, NupC has 9 or 10 predicted TMSs in a 4 + 1 (or 2) + 4 arrangement (characterized) 32% 95% 250 deoxynucleoside transporter, ATPase component 64% 632.9
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 37% 95% 164.1 deoxynucleoside transporter, ATPase component 64% 632.9
D-mannose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 36% 94% 147.1 deoxynucleoside transporter, ATPase component 64% 632.9
D-ribose catabolism frcA lo Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) 36% 94% 147.1 deoxynucleoside transporter, ATPase component 64% 632.9

Sequence Analysis Tools

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MPTTASVLIRDSAPREATSPPFLDIRDVHKRFAGVKALRGVSLAIERGQIYHLLGENGCG
KSTLIKIISGAQPPDEGTLVVEGREVAGLSPIMALAAGIETVYQDLSLLPNLSVAENIAL
SQQLVASGGQLARRLDLARLKATATRALEAVNLPAGDGFLATRVDELPIATRQLIAIARV
IATDAKLVIMDEPTTALTKREVDNLIAVVEKLRAKGVAVLFVTHKLDECRTIGGRAIILR
DGRKVMEGDIADFTKKDLSHWMTGRALDDSRYREAERGGERLLDVRDLGRANAFGGVSFS
LNRGEILGVTGLLDSGRNELALALAGVCPADRGGVSLAGERVVLSQPADAIAAGIGYLPE
DRLSEGLFLEKPIADNIIASVLDRLRGRLGMLDRPLSRSRAQEMTDDLQIATPDIANPVQ
SLSGGNQQRVLIGRWLMIEPRLLVLHGPTVGVDVGSKDTIFRIIQRLAKGGMAVIIISDD
LPELLQNCDRILVMRKGRVAEVFDAEGLGEGALYRALVAEESPRSLP

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory