Align acetyl-CoA:acetoacetyl-CoA transferase subunit &beta (characterized)
to candidate YP_426470.1 Rru_A1382 butyryl-CoA:acetate CoA transferase
Query= ecocyc::ATOA-MONOMER (216 letters) >NCBI__GCF_000013085.1:YP_426470.1 Length = 218 Score = 238 bits (608), Expect = 5e-68 Identities = 125/211 (59%), Positives = 151/211 (71%), Gaps = 4/211 (1%) Query: 1 MDAKQRIARRVAQELRDGDIVNLGIGLPTMVANYLPEGIHITLQSENGFLGLGPVTT--- 57 MDAK IARRVAQEL G++VNLGIGLPT+VANYLP G+ + QSENG +G+ P+ Sbjct: 1 MDAKTLIARRVAQELTQGNLVNLGIGLPTLVANYLPPGMSVFFQSENGIIGMQPLEGPGG 60 Query: 58 AHPDLVNAGGQPCGVLPGAAMFDSAMSFALIRGGHIDACVLGGLQVDEEANLANWVVPGK 117 + L +AGG P G++PGAA FDS SF IRGGH+D VLGGLQVDE LANWVVPGK Sbjct: 61 SSEALTDAGGAPTGIIPGAAAFDSVSSFGFIRGGHLDVTVLGGLQVDEAGQLANWVVPGK 120 Query: 118 MVPGMGGAMDLVTGSRKVIIAMEHCAKDGSAKILRRCTMPLTAQHAVHMLVTELAVFRFI 177 MVPGMGGAMDLVTG+R+VI+AM H AK G+ KIL+ CT+PLT+ + ++VTE+AV Sbjct: 121 MVPGMGGAMDLVTGARRVIVAMTHTAK-GAPKILKACTLPLTSVRRIDLIVTEMAVIEPT 179 Query: 178 DGKMWLTEIADGCDLATVRAKTEARFEVAAD 208 D + L E A G L V A TEAR V + Sbjct: 180 DAGLVLRERAPGVSLEAVIAATEARLIVEGE 210 Lambda K H 0.322 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 218 Length adjustment: 22 Effective length of query: 194 Effective length of database: 196 Effective search space: 38024 Effective search space used: 38024 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory