Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate YP_427213.1 Rru_A2126 5-oxopent-3-ene-1,2,5-tricarboxylate decarboxylase
Query= BRENDA::A0A076VF18 (308 letters) >NCBI__GCF_000013085.1:YP_427213.1 Length = 280 Score = 142 bits (357), Expect = 1e-38 Identities = 93/242 (38%), Positives = 126/242 (52%), Gaps = 30/242 (12%) Query: 69 LSPLAPTDVPAIRG----------------MGLQYSGDPANP-QDKPPVACLFFKASQAL 111 LS L P D+P + G +GL YS A P +F KA+ A+ Sbjct: 46 LSNLDPADLPLVEGQPRLGPCVGHVGKLICIGLNYSDHAAETGASVPSEPIVFLKATSAI 105 Query: 112 AGPGDDIVLPRLARDEKNDYEVELCVVLGKDAKDVDEKDAMSFVGGYCVVNDVSSRGL-C 170 GP DD+ LPR K D+EVEL VV+G AK V E+DA+ V GYCVV+DVS R Sbjct: 106 VGPNDDLELPR--GSTKTDWEVELGVVIGTPAKYVSEEDALDHVAGYCVVHDVSERAFQL 163 Query: 171 AKGGQWGMGKSYDTWCPFGPCLVSPSALGADPHKLTITTHVNGKLAQKGNTADLVLKIPE 230 + GQW GKS DT+ P GP LV+ + ADP L + VNG+ Q G+T ++ + Sbjct: 164 ERQGQWTKGKSCDTFGPIGPWLVTADEI-ADPQDLDLWLEVNGERRQTGSTRTMIFGVAR 222 Query: 231 LIARLSHGTTLQAGSLILTGSPIALGRKAPGDAVEQSP--FMKDGDEIRCFVEGCGTLIN 288 L++ LS TL G ++ TG+P PG + +P F++ GD +R VEG G Sbjct: 223 LVSYLSQIMTLHPGDILSTGTP-------PGVGLGMTPPTFLQPGDVVRLGVEGLGVQCQ 275 Query: 289 SV 290 +V Sbjct: 276 TV 277 Lambda K H 0.316 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 265 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 280 Length adjustment: 26 Effective length of query: 282 Effective length of database: 254 Effective search space: 71628 Effective search space used: 71628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory