Align Glycine betaine/proline betaine transport system permease protein ProW (characterized)
to candidate YP_427471.1 Rru_A2384 binding-protein dependent transport system inner membrane protein
Query= SwissProt::P14176 (354 letters) >NCBI__GCF_000013085.1:YP_427471.1 Length = 392 Score = 113 bits (282), Expect = 1e-29 Identities = 83/263 (31%), Positives = 130/263 (49%), Gaps = 27/263 (10%) Query: 93 ILNGFQQLLLGMPAPVAIIVF------ALIAWQISGVGMGVATLVSLIAIGAIGAWSQAM 146 +L G L+ P P+A ++ AL SG GV+ L A A W +A Sbjct: 119 LLLGTDALVRLRPGPLARLLALGALFGALGLLLASGQWDGVSVLKEY-ANRADAFWREAR 177 Query: 147 VTLALVLTALLFCIVIGLPLGIWLARSPRAAKIIRPLLDAMQTTPAF----VYLVPIVML 202 LAL L A+ +GLPLG+ R ++ L +QT P+ + + P+ L Sbjct: 178 THLALALGAVAVACAVGLPLGVLCHRVAWLRGMVLQGLTIIQTIPSIALFGILMAPLGWL 237 Query: 203 F------------GIGNVPGVVVTIIFALPPIIRLTILGINQVPADLIEASRSFGASPRQ 250 GIG P +V I++AL P++ T++G+ QVPA ++A+R G + Sbjct: 238 AAHVPAIAALGVRGIGATPALVALILYALLPVVANTVVGLAQVPAATVDAARGMGMGRGR 297 Query: 251 MLFKVQLPLAMPTIMAGVNQTLMLALSMVVIASMIAVGGLGQMVLRGIGRLDMGLATVGG 310 +L +V+LPLA+P I+ GV L+ A+ + +A++I GG G V +G+G+ M L +G Sbjct: 298 LLREVELPLALPVILTGVRIVLVQAIGLTTVAALIGGGGFGTFVFQGVGQAAMDLVLLGA 357 Query: 311 VGIVIL----AIILDRLTQAVGR 329 + V L A+ILD L + R Sbjct: 358 LPTVALAFGAAVILDALIEGARR 380 Lambda K H 0.326 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 460 Number of extensions: 32 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 392 Length adjustment: 30 Effective length of query: 324 Effective length of database: 362 Effective search space: 117288 Effective search space used: 117288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory