Align glucokinase (EC 2.7.1.2) (characterized)
to candidate YP_427714.1 Rru_A2630 N-acetylglucosamine kinase
Query= reanno::SB2B:6938110 (299 letters) >NCBI__GCF_000013085.1:YP_427714.1 Length = 310 Score = 314 bits (805), Expect = 1e-90 Identities = 160/296 (54%), Positives = 198/296 (66%), Gaps = 1/296 (0%) Query: 2 MRMGVDLGGTKIELVALGEDGSELFRKRIATPRE-YQGTLNAVVTLVNEAEATLGTQGSL 60 +R+G+DLGGTK E++AL ++G L R+R +PR Y TL+ + LV EAEA LG QGS+ Sbjct: 3 LRLGLDLGGTKTEIIALDDEGRILLRRRRPSPRAAYGATLDCLAALVTEAEAELGRQGSV 62 Query: 61 GIGIPGVISPYTGLVKNANSTWINGHPLDRDLGALLNREVRVANDANCFAVSEAVDGAAA 120 G+ +PG ISP +GLVKNANS W+NG LD DL L R VRVANDA+CFA+SEA DGAAA Sbjct: 63 GVAMPGAISPASGLVKNANSHWLNGQRLDHDLAERLGRPVRVANDADCFALSEATDGAAA 122 Query: 121 GKRVVFGAILGTGCGAGLAFDGRVHEGGNGIGGEWGHNPLPWMRPDEFNTTECFCGNKDC 180 G VFG ILGTG GAG+ +GR+ G N I GEWGH PLPW DE +C+CG K C Sbjct: 123 GASSVFGVILGTGVGAGIVVNGRLLAGPNAIAGEWGHMPLPWPGDDERPGPDCYCGLKGC 182 Query: 181 IETFVSGTGFVRDFRNSGGTAQNGAEIMSLVDAGDELANLVFDRYLDRLARSLAHVINML 240 +ETF SG G D + S G A G +++L AGD A DR+ DRLAR+LA VIN+L Sbjct: 183 VETFCSGPGLAADHQKSTGHAIEGPALLALAQAGDAQAQASLDRHADRLARALAVVINIL 242 Query: 241 DPDAIVLGGGMSNVQAIYARLPAILPKYVVGRECRTPVVQNLYGCSSGVRGAAWLW 296 DP IVLGGG+ + +Y LP + +V T +V +G SSGVRGAAWLW Sbjct: 243 DPQVIVLGGGLGQMPHLYQALPRLWTPWVFSDRVDTRLVAPRHGDSSGVRGAAWLW 298 Lambda K H 0.320 0.139 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 310 Length adjustment: 27 Effective length of query: 272 Effective length of database: 283 Effective search space: 76976 Effective search space used: 76976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory