Align Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 (characterized)
to candidate YP_428275.1 Rru_A3193 glutathione S-transferase-like protein
Query= SwissProt::P57113 (216 letters) >NCBI__GCF_000013085.1:YP_428275.1 Length = 222 Score = 60.1 bits (144), Expect = 3e-14 Identities = 64/200 (32%), Positives = 95/200 (47%), Gaps = 13/200 (6%) Query: 6 PVLYSYFRSSCSWRVRIALALK--GIDYEIVPINLIKDGGQQFSEEFQTLNPMKQVPALK 63 P L R+ SW +R ALK GI ++ V I L + G + E+ +P +VP L Sbjct: 4 PTLVIGNRNYSSWSMRPWFALKVAGIAFDEVVIPLYEPGSK---EKMAAASPTGKVPCLI 60 Query: 64 IDGITIGQSLAILEYLEETRPIPRLLPQDPQKRAIVRMISDLIASGIQPLQN---LSVLK 120 DG+TI SLAIL+YL E P L P + RA R +S + SG Q L+ ++V K Sbjct: 61 DDGLTIWDSLAILDYLAERFPEAHLWPAERAARARARAVSAEMHSGFQALRQALIMNVRK 120 Query: 121 QVGQENQMPWAQKAITSGFNALEKILQSTAGKY--CVGDEVSMADVCLAPQVANAERFKV 178 + P + A + AL + G+ + S+AD AP V + V Sbjct: 121 TFPPQPLSPEVE-ADVARIEALWAECRRDFGQQGPFLFGAFSIADAMYAPVVTRLRTYGV 179 Query: 179 DLSPYPTISHINKALLALEA 198 + P T ++++ A+LAL A Sbjct: 180 AVGP-ETRAYMD-AILALPA 197 Lambda K H 0.319 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 104 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 222 Length adjustment: 22 Effective length of query: 194 Effective length of database: 200 Effective search space: 38800 Effective search space used: 38800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory