Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate YP_428588.1 Rru_A3507 inner-membrane translocator
Query= uniprot:A0A165KER0 (358 letters) >NCBI__GCF_000013085.1:YP_428588.1 Length = 373 Score = 157 bits (396), Expect = 6e-43 Identities = 98/311 (31%), Positives = 163/311 (52%), Gaps = 36/311 (11%) Query: 39 YVLLALGLNIVVGYAGLLDLGYVAFYAVGAYLFALMASPHLADNFAAFAAMFPNGLHTSL 98 Y + ALGLNI+VG+ G + LG+ AF+ VGA+ +A + + Sbjct: 76 YAIAALGLNILVGFTGQISLGHAAFFGVGAFS----------------SAWLNTRVGLPV 119 Query: 99 WIVIPVAALLAAFFGAMLGAPTLKLRGDYLAIVTLGFGEIIRIFLNNLDHPVNLTNGPKG 158 + IP+A L++A G + GAP +++G YLAI TL II +D T G G Sbjct: 120 LVCIPLAGLMSAAAGLLFGAPAARIKGLYLAIATLAAQFIIEDLFVRMDW---FTGGSSG 176 Query: 159 LGQIDSVKVFGLDLGKRLEVFGFDINSVTLYYYLFLVLVVVSVIICYRLQDSRIGRAWMA 218 D+ L F FD ++ Y+ L L +V ++ L SR GRA++A Sbjct: 177 -AMADT---------PMLGSFAFDNDA--RYFLLSLSFTIVLFVMAANLMRSRDGRAFVA 224 Query: 219 IREDEIAAKAMGINTRNMKLLAFGMGASFGGVSGAMFGAFQGFVSPESFSLMESVMIVAM 278 +R+ ++A+ MGI ++++FG+ A + G+ GA++G + FVS E+F+++ S+ + M Sbjct: 225 LRDHYLSAEVMGIALTRYRVMSFGIAAFYAGIGGALYGHYLMFVSAEAFTILLSIQFLGM 284 Query: 279 VVLGGIGHIPGVILGAVLLSALPEVLRYVAGPLQAMTDGRLDSAI-----LRQLLIALAM 333 +++GG+G + G +LG + + ALPEV+ V LQ G + I R++ I A+ Sbjct: 285 IIIGGLGSVMGAMLGTIFMVALPEVMGAVIAALQTTQWGNRPAVINGLPFFREMAIGAAI 344 Query: 334 IIIMLLRPRGL 344 I+ ++ P GL Sbjct: 345 ILFLIFEPDGL 355 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 373 Length adjustment: 30 Effective length of query: 328 Effective length of database: 343 Effective search space: 112504 Effective search space used: 112504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory