Align Leucine ABC transporter subunit substrate-binding protein LivK (characterized, see rationale)
to candidate YP_428809.1 Rru_A3728 extracellular ligand-binding receptor
Query= uniprot:A0A160A0J6 (375 letters) >NCBI__GCF_000013085.1:YP_428809.1 Length = 392 Score = 130 bits (328), Expect = 5e-35 Identities = 105/352 (29%), Positives = 161/352 (45%), Gaps = 16/352 (4%) Query: 4 ATKQISKLFAAMVLA-GVASHSFAADTIKIGIAGPKTGPVAQYGDMQFSGSKMAIEQINA 62 +T + L A LA G A + +AD IKIG A TG A +G+++AI+ +NA Sbjct: 5 STTRAGLLAGAFALAIGFAGPAASADPIKIGGAFNLTGGQASLDGPAKNGAQLAIDTLNA 64 Query: 63 KGGVNGKQLVAVEYDDACDPKQAVAVANKVVN-DGIKFVVGHLCSSSTQPASDIYEDEGV 121 GGVNG L V YD DP ++ ++++N D + ++G S + GV Sbjct: 65 AGGVNGTPLELVVYDGKTDPAVVASLGSQLINSDKVSAIIGFSDSDPVLALGPNAQKAGV 124 Query: 122 VMITPAATSPDITARGYKMIFRTIGLDSAQGPAAGNYIADHVKPKIVAVLHD-KQQYGEG 180 I ATSP + + +F D+ Q ++ D +K K V VL D +Y Sbjct: 125 PFIAVGATSPKLPDQIGDTMFLACFGDNTQAAVGASFAIDDLKAKSVYVLEDTANEYATL 184 Query: 181 IASAVKKTLEDKGVKVAVFEGVNAGDKDFSSMIAKLKQA--NVDFVYYGGYHPELGLILR 238 ++ ++T E G KV + GDK F++ I K+K A D +Y +GL++R Sbjct: 185 LSKYFRETFEHLGGKVIGRDTYRTGDKSFTAQITKIKAAAEKPDILYIAATPDSIGLVVR 244 Query: 239 QSQEKGLKAKFMGPEGVGNDSISQIAKESSEGLLVTLPKSFDQDPANIALADAF----KA 294 Q ++ GLK +G +G + ++ S+ + T SF D A + F KA Sbjct: 245 QVRQAGLKLPIVGGDGYDTPLLLEVGGASANNVYFT-THSFVSDSAPGPMKTFFDAYGKA 303 Query: 295 KKEDPSGPFVFPSYSAVTVIADAIKAAKSEDAGKVAEAIHAGTFKTPTGDLS 346 P F Y V ++ADAIK A S D + +A+ T T DL+ Sbjct: 304 YGNAPENAFAALGYDTVMLVADAIKRAGSGDPAAIRKAL------TETKDLA 349 Lambda K H 0.314 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 392 Length adjustment: 30 Effective length of query: 345 Effective length of database: 362 Effective search space: 124890 Effective search space used: 124890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory