Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate YP_428882.1 Rru_A3801 short-chain enoyl-CoA hydratase
Query= BRENDA::A4YI89 (259 letters) >NCBI__GCF_000013085.1:YP_428882.1 Length = 258 Score = 212 bits (540), Expect = 5e-60 Identities = 114/258 (44%), Positives = 166/258 (64%), Gaps = 5/258 (1%) Query: 1 MEFETIETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKA 60 M +E I + G + +TLNRP LNAL+A L+ +L A+ E+D + VI++TG KA Sbjct: 1 MAYENILVETNGKVGIVTLNRPKALNALSAGLVRDLGAALDAFEADVNVHVIVLTGSDKA 60 Query: 61 FCAGADITQFNQLTPAEAW--KFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALAC 118 F AGADI + + + +A+ F KG E ++ KP IA + G+ALGGG E+A+ C Sbjct: 61 FAAGADIKEMAEKSYMDAYLEDFITKGWE---RVTTCRKPIIAAVAGFALGGGCEMAMMC 117 Query: 119 DIRIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLV 178 D IAA+ A+ G PEINLG PG GGTQRLTR +GK +A++M +TG + +A K GLV Sbjct: 118 DFIIAAQNAKFGQPEINLGTLPGAGGTQRLTRFVGKSKAMDMCLTGRMMDADEAWKCGLV 177 Query: 179 NRVVPLANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFST 238 +R+VP+ +L+ E K+AE IA KS ++KE VN ++ L G+ E + F+T Sbjct: 178 SRIVPVDDLKDEVLKIAEAIADKSLPITMMVKEAVNAAYETTLAQGVRFERRLFQASFAT 237 Query: 239 EDKKEGVSAFLEKREPTF 256 +D+KEG++AF+EKR+P+F Sbjct: 238 DDQKEGMNAFIEKRQPSF 255 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 258 Length adjustment: 24 Effective length of query: 235 Effective length of database: 234 Effective search space: 54990 Effective search space used: 54990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory