GapMind for catabolism of small carbon sources

 

Protein WP_057507764.1 in Stenotrophomonas chelatiphaga DSM 21508

Annotation: NCBI__GCF_001431535.1:WP_057507764.1

Length: 378 amino acids

Source: GCF_001431535.1 in NCBI

Candidate for 91 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
putrescine catabolism potA hi PotG aka B0855, component of Putrescine porter (characterized) 58% 99% 406.4 MalK aka PF1933, component of Maltooligosaccharide porter (Maltose is not a substrate, but maltotriose is.) 44% 260.0
D-maltose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 43% 91% 250 PotG aka B0855, component of Putrescine porter 58% 406.4
trehalose catabolism thuK med Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 43% 91% 250 PotG aka B0855, component of Putrescine porter 58% 406.4
L-arabinose catabolism xacK med Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 41% 84% 234.6 PotG aka B0855, component of Putrescine porter 58% 406.4
D-maltose catabolism malK med Maltose-transporting ATPase (EC 3.6.3.19) (characterized) 43% 79% 233.8 PotG aka B0855, component of Putrescine porter 58% 406.4
D-sorbitol (glucitol) catabolism mtlK med ABC transporter for D-Sorbitol, ATPase component (characterized) 40% 85% 229.6 PotG aka B0855, component of Putrescine porter 58% 406.4
lactose catabolism lacK med ABC transporter for Lactose, ATPase component (characterized) 42% 78% 226.1 PotG aka B0855, component of Putrescine porter 58% 406.4
D-cellobiose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 86% 222.2 PotG aka B0855, component of Putrescine porter 58% 406.4
D-glucose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 86% 222.2 PotG aka B0855, component of Putrescine porter 58% 406.4
lactose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 86% 222.2 PotG aka B0855, component of Putrescine porter 58% 406.4
D-maltose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 86% 222.2 PotG aka B0855, component of Putrescine porter 58% 406.4
D-mannose catabolism TT_C0211 med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 86% 222.2 PotG aka B0855, component of Putrescine porter 58% 406.4
sucrose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 86% 222.2 PotG aka B0855, component of Putrescine porter 58% 406.4
sucrose catabolism thuK med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 86% 222.2 PotG aka B0855, component of Putrescine porter 58% 406.4
trehalose catabolism gtsD med Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 41% 86% 222.2 PotG aka B0855, component of Putrescine porter 58% 406.4
D-maltose catabolism malK1 med MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 40% 87% 220.7 PotG aka B0855, component of Putrescine porter 58% 406.4
D-maltose catabolism malK_Bb med ABC-type maltose transport, ATP binding protein (characterized, see rationale) 45% 71% 219.5 PotG aka B0855, component of Putrescine porter 58% 406.4
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 40% 78% 218.8 PotG aka B0855, component of Putrescine porter 58% 406.4
D-maltose catabolism malK_Aa med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 40% 80% 208.8 PotG aka B0855, component of Putrescine porter 58% 406.4
N-acetyl-D-glucosamine catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 46% 70% 206.1 PotG aka B0855, component of Putrescine porter 58% 406.4
D-glucosamine (chitosamine) catabolism SMc02869 med N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 46% 70% 206.1 PotG aka B0855, component of Putrescine porter 58% 406.4
D-maltose catabolism musK med ABC-type maltose transporter (EC 7.5.2.1) (characterized) 42% 73% 205.3 PotG aka B0855, component of Putrescine porter 58% 406.4
L-histidine catabolism hutV med ABC transporter for L-Histidine, ATPase component (characterized) 40% 81% 168.7 PotG aka B0855, component of Putrescine porter 58% 406.4
L-histidine catabolism Ac3H11_2560 med ABC transporter for L-Histidine, ATPase component (characterized) 45% 73% 156.8 PotG aka B0855, component of Putrescine porter 58% 406.4
D-mannitol catabolism mtlK lo ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized) 38% 97% 229.2 PotG aka B0855, component of Putrescine porter 58% 406.4
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 40% 91% 226.5 PotG aka B0855, component of Putrescine porter 58% 406.4
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 38% 92% 220.7 PotG aka B0855, component of Putrescine porter 58% 406.4
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 39% 90% 215.7 PotG aka B0855, component of Putrescine porter 58% 406.4
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 35% 98% 213.8 PotG aka B0855, component of Putrescine porter 58% 406.4
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 39% 88% 213.8 PotG aka B0855, component of Putrescine porter 58% 406.4
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 35% 98% 213.8 PotG aka B0855, component of Putrescine porter 58% 406.4
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 35% 98% 213.8 PotG aka B0855, component of Putrescine porter 58% 406.4
trehalose catabolism malK lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 39% 88% 213.8 PotG aka B0855, component of Putrescine porter 58% 406.4
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 46% 61% 204.1 PotG aka B0855, component of Putrescine porter 58% 406.4
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 37% 84% 203.8 PotG aka B0855, component of Putrescine porter 58% 406.4
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 36% 82% 200.3 PotG aka B0855, component of Putrescine porter 58% 406.4
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 45% 61% 198.7 PotG aka B0855, component of Putrescine porter 58% 406.4
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 86% 195.3 PotG aka B0855, component of Putrescine porter 58% 406.4
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 86% 195.3 PotG aka B0855, component of Putrescine porter 58% 406.4
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 86% 195.3 PotG aka B0855, component of Putrescine porter 58% 406.4
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 86% 195.3 PotG aka B0855, component of Putrescine porter 58% 406.4
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 86% 195.3 PotG aka B0855, component of Putrescine porter 58% 406.4
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 37% 86% 195.3 PotG aka B0855, component of Putrescine porter 58% 406.4
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 87% 194.1 PotG aka B0855, component of Putrescine porter 58% 406.4
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 87% 194.1 PotG aka B0855, component of Putrescine porter 58% 406.4
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 87% 194.1 PotG aka B0855, component of Putrescine porter 58% 406.4
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 87% 194.1 PotG aka B0855, component of Putrescine porter 58% 406.4
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 87% 194.1 PotG aka B0855, component of Putrescine porter 58% 406.4
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 87% 194.1 PotG aka B0855, component of Putrescine porter 58% 406.4
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 87% 194.1 PotG aka B0855, component of Putrescine porter 58% 406.4
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 35% 87% 194.1 PotG aka B0855, component of Putrescine porter 58% 406.4
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 37% 82% 191.8 PotG aka B0855, component of Putrescine porter 58% 406.4
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 38% 82% 191.4 PotG aka B0855, component of Putrescine porter 58% 406.4
L-proline catabolism proV lo Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) 39% 61% 177.2 PotG aka B0855, component of Putrescine porter 58% 406.4
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 35% 65% 171 PotG aka B0855, component of Putrescine porter 58% 406.4
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 66% 168.3 PotG aka B0855, component of Putrescine porter 58% 406.4
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 66% 168.3 PotG aka B0855, component of Putrescine porter 58% 406.4
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 66% 168.3 PotG aka B0855, component of Putrescine porter 58% 406.4
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 38% 66% 168.3 PotG aka B0855, component of Putrescine porter 58% 406.4
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 39% 81% 165.6 PotG aka B0855, component of Putrescine porter 58% 406.4
glycerol catabolism glpS lo GlpS, component of Glycerol uptake porter, GlpSTPQV (characterized) 31% 89% 155.2 PotG aka B0855, component of Putrescine porter 58% 406.4
L-asparagine catabolism aatP lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 37% 91% 152.5 PotG aka B0855, component of Putrescine porter 58% 406.4
L-aspartate catabolism aatP lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 37% 91% 152.5 PotG aka B0855, component of Putrescine porter 58% 406.4
L-glutamate catabolism gltL lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 37% 91% 152.5 PotG aka B0855, component of Putrescine porter 58% 406.4
glycerol catabolism glpT lo GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized) 33% 84% 151 PotG aka B0855, component of Putrescine porter 58% 406.4
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 36% 94% 150.2 PotG aka B0855, component of Putrescine porter 58% 406.4
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-glucosamine, ATPase component (characterized) 34% 98% 149.1 PotG aka B0855, component of Putrescine porter 58% 406.4
L-lysine catabolism hisP lo Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 37% 93% 148.3 PotG aka B0855, component of Putrescine porter 58% 406.4
L-asparagine catabolism glnQ lo Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 35% 96% 147.5 PotG aka B0855, component of Putrescine porter 58% 406.4
L-histidine catabolism aapP lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 35% 97% 145.2 PotG aka B0855, component of Putrescine porter 58% 406.4
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 93% 142.9 PotG aka B0855, component of Putrescine porter 58% 406.4
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 93% 142.9 PotG aka B0855, component of Putrescine porter 58% 406.4
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 93% 142.9 PotG aka B0855, component of Putrescine porter 58% 406.4
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 93% 142.9 PotG aka B0855, component of Putrescine porter 58% 406.4
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 35% 93% 142.9 PotG aka B0855, component of Putrescine porter 58% 406.4
L-arginine catabolism artP lo Arginine transport ATP-binding protein ArtM (characterized) 33% 99% 141.4 PotG aka B0855, component of Putrescine porter 58% 406.4
L-isoleucine catabolism livG lo High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale) 30% 98% 126.3 PotG aka B0855, component of Putrescine porter 58% 406.4
L-phenylalanine catabolism livG lo High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG (characterized, see rationale) 30% 98% 126.3 PotG aka B0855, component of Putrescine porter 58% 406.4
D-cellobiose catabolism cbtD lo CbtD, component of Cellobiose and cellooligosaccharide porter (characterized) 33% 72% 124 PotG aka B0855, component of Putrescine porter 58% 406.4
L-tryptophan catabolism ecfA1 lo Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale) 36% 80% 122.9 PotG aka B0855, component of Putrescine porter 58% 406.4
L-proline catabolism HSERO_RS00895 lo ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) 31% 97% 122.1 PotG aka B0855, component of Putrescine porter 58% 406.4
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 32% 98% 119.4 PotG aka B0855, component of Putrescine porter 58% 406.4
D-cellobiose catabolism cbtF lo CbtF, component of Cellobiose and cellooligosaccharide porter (characterized) 31% 76% 115.5 PotG aka B0855, component of Putrescine porter 58% 406.4
L-leucine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized) 31% 94% 113.6 PotG aka B0855, component of Putrescine porter 58% 406.4
L-valine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized) 31% 94% 113.6 PotG aka B0855, component of Putrescine porter 58% 406.4
L-alanine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 33% 90% 107.8 PotG aka B0855, component of Putrescine porter 58% 406.4
L-isoleucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 33% 90% 107.8 PotG aka B0855, component of Putrescine porter 58% 406.4
L-leucine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 33% 90% 107.8 PotG aka B0855, component of Putrescine porter 58% 406.4
L-serine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 33% 90% 107.8 PotG aka B0855, component of Putrescine porter 58% 406.4
L-threonine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 33% 90% 107.8 PotG aka B0855, component of Putrescine porter 58% 406.4
L-valine catabolism livF lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 33% 90% 107.8 PotG aka B0855, component of Putrescine porter 58% 406.4

Sequence Analysis Tools

View WP_057507764.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MPAEALPEAAVIDTHGEPGYLSIRDLRKEFDGFVAVDDVNLDVRKGEIFALLGGSGSGKS
TLLRCLGGFETPTRGSIVLDGQPLVALPPYKRPVNMMFQSYALFPHMSVEQNIAFGLKQD
GLAGDAIRRRVGEMLELVHMTSLAKRRPHQLSGGQQQRVALARSLAKGPKLLLLDEPMGA
LDKKLRSQMQLELVNIIETSGVTCVMVTHDQEEAMTMATRIAVMDAGWIQQVGKPDEVYE
QPANRFVAGFIGSVNSFEGVIDEDLPEYVTVRSPAFPAPIYIGHGITCYEGQPVAFAVRP
EKIIIGKDEPEGHTNKAQGVIEDIAYFGSHSVYHVRLPSGAKVMANFANSQRWASDGLTW
GDEVWVHWRDNDGVVLTS

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory