Align subunit of 3-oxoadipate enol-lactone hydrolase (EC 3.1.1.24) (characterized)
to candidate WP_057508462.1 ABB28_RS09865 3-oxoadipate enol-lactonase
Query= metacyc::MONOMER-3221 (263 letters) >NCBI__GCF_001431535.1:WP_057508462.1 Length = 259 Score = 232 bits (592), Expect = 5e-66 Identities = 122/253 (48%), Positives = 158/253 (62%), Gaps = 3/253 (1%) Query: 1 MAHLQLADGVLNYQIDGPDDAPVLVLSNSLGTDLGMWDTQIPLWSQHFRVLRYDTRGHGA 60 MA L+L L Y ++GP DAP L NSLGTDL MW+ Q +S FRVLRYD RGHG Sbjct: 1 MAFLELPRHRLRYVVEGPADAPWLTFCNSLGTDLHMWEPQARAFSGRFRVLRYDRRGHGL 60 Query: 61 SLVTEGPYSIEQLGRDVLALLDGLDIQKAHFVGLSMGGLIGQWLGIHAGERLHSLTLCNT 120 S G Y+++ LG DVLAL + L I+++HF GLS+GGL GQWLG+HAGERL SLT+ T Sbjct: 61 SSTPPGLYTVDDLGADVLALWNHLGIERSHFCGLSIGGLTGQWLGVHAGERLLSLTVAAT 120 Query: 121 AAKIANDEVWNTRIDTVLKGGQQAMVDLRDASIARWFTPGFAQAQAEQAQRICQMLAQTS 180 AAKI + E W RID V G Q ++ + + RWF+ FAQ A+Q + I Q TS Sbjct: 121 AAKIGSLESWRARIDQVRAAGLQPLL---EGTRERWFSTAFAQTHAQQVEDILQRFLTTS 177 Query: 181 PQGYAGNCAAVRDADYREQLGRIQVPALIVAGTQDVVTTPEHGRFMQAGIQGAEYVDFPA 240 +GYAG C AV AD+R++L I+VP L +AG QD V P + + G+ Y P Sbjct: 178 AEGYAGCCNAVGHADFRDRLADIRVPTLAIAGDQDPVCPPADLQAIATGVAQGRYASVPG 237 Query: 241 AHLSNVEIGEAFS 253 H+ N+E +AF+ Sbjct: 238 RHICNLESVDAFN 250 Lambda K H 0.321 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 259 Length adjustment: 25 Effective length of query: 238 Effective length of database: 234 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate WP_057508462.1 ABB28_RS09865 (3-oxoadipate enol-lactonase)
to HMM TIGR02427 (pcaD: 3-oxoadipate enol-lactonase (EC 3.1.1.24))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02427.hmm # target sequence database: /tmp/gapView.1972.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02427 [M=251] Accession: TIGR02427 Description: protocat_pcaD: 3-oxoadipate enol-lactonase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-99 318.6 0.1 1.5e-99 318.4 0.1 1.0 1 lcl|NCBI__GCF_001431535.1:WP_057508462.1 ABB28_RS09865 3-oxoadipate enol- Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_001431535.1:WP_057508462.1 ABB28_RS09865 3-oxoadipate enol-lactonase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 318.4 0.1 1.5e-99 1.5e-99 1 250 [. 10 257 .. 10 258 .. 0.99 Alignments for each domain: == domain 1 score: 318.4 bits; conditional E-value: 1.5e-99 TIGR02427 1 rlhyrlegaeadkpvlvlinSLGtdlrlwdkvlealtkdfrvlryDkrGHGlSdvpegpysiedladdv 69 rl y +eg++ d+p+l+++nSLGtdl++w++++ a++ +frvlryD+rGHGlS+ p g y+++dl+ dv lcl|NCBI__GCF_001431535.1:WP_057508462.1 10 RLRYVVEGPA-DAPWLTFCNSLGTDLHMWEPQARAFSGRFRVLRYDRRGHGLSSTPPGLYTVDDLGADV 77 589*******.********************************************************** PP TIGR02427 70 lallDalgiekaavcGlSlGGliaqaLaarrpdrvealvlsntaakigtaesWeaRiaavraeGlaala 138 lal+ +lgie++++cGlS+GGl++q+L++++++r+ +l +++taakig+ esW aRi++vra Gl+ l lcl|NCBI__GCF_001431535.1:WP_057508462.1 78 LALWNHLGIERSHFCGLSIGGLTGQWLGVHAGERLLSLTVAATAAKIGSLESWRARIDQVRAAGLQPLL 146 ********************************************************************* PP TIGR02427 139 davlerwFtpafreaepaelelvrnmlveqppegYaatcaAirdadlrerleeiavPtlviaGdeDgst 207 +++ erwF+ af++++++++e++ + ++++++egYa++c+A+ ad+r+rl +i+vPtl+iaGd+D+++ lcl|NCBI__GCF_001431535.1:WP_057508462.1 147 EGTRERWFSTAFAQTHAQQVEDILQRFLTTSAEGYAGCCNAVGHADFRDRLADIRVPTLAIAGDQDPVC 215 ********************************************************************* PP TIGR02427 208 PpelvreiadlvpgarfaeieeaaHlpnleqpeafaallrdfl 250 Pp+++++ia+ v+++r+a ++ ++H++nle+ +af+a+l+++l lcl|NCBI__GCF_001431535.1:WP_057508462.1 216 PPADLQAIATGVAQGRYASVP-GRHICNLESVDAFNAALAAHL 257 *********************.*******************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (251 nodes) Target sequences: 1 (259 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.67 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory