Align Glucose kinase (characterized, see rationale)
to candidate WP_083492046.1 ABB28_RS14545 glucokinase
Query= uniprot:Q8P6S9 (338 letters) >NCBI__GCF_001431535.1:WP_083492046.1 Length = 374 Score = 366 bits (940), Expect = e-106 Identities = 189/333 (56%), Positives = 238/333 (71%), Gaps = 3/333 (0%) Query: 2 SASSPMEAVAFPRPETFVAADVGGTHVRLALACESNDPRKPVTVLDYRKYRCADYPGLAE 61 S +P A++ P F+AADVGGTHVR+A S D PV VLDYRKYR AD+PGL Sbjct: 40 SHPAPTHALSTAAPG-FLAADVGGTHVRVARVEASGDAAHPVRVLDYRKYRNADHPGLGA 98 Query: 62 IMAAFFAELSCAPVRRGVIASAGYALEDGRVITANLPWVLAPEQIRQQLGMQALHLVNDF 121 I++ F + P V+A+AGYA EDG VITAN+PW L+ Q+ ++G+Q +H+VNDF Sbjct: 99 ILSDFLGD-GMRPAHC-VVATAGYAREDGTVITANVPWPLSARQLETEVGVQHVHIVNDF 156 Query: 122 EAVAYAANYMTGNQVMQLSGPAQGAPGPALVLGPGTGLGAALWIPNGGNSVVLPTEAGHA 181 EAVA+AA + + V+QL GP GP LV+GPGTGLGAALWIP VVL TEAG A Sbjct: 157 EAVAHAAAQVDASGVLQLCGPHSAPIGPTLVVGPGTGLGAALWIPTAHGPVVLATEAGQA 216 Query: 182 ALAAASDLEVALLQELRRTRTHVATEHFLSGPGLLTLYTALATLRDAPAVHATPAAVTAA 241 +LAA+ LE+A+L+ + R R+HV+ EH LSGPGL+ LYTAL L D PA+ +P AVTAA Sbjct: 217 SLAASDALEMAILRHMLRGRSHVSVEHALSGPGLINLYTALCALEDRPALLGSPDAVTAA 276 Query: 242 ALAGDDVLAHEALQTFCGFMGSVVGDMMLLYGVRSGVYLAGGFLPQIADFIARSDFAARL 301 A+AG D LA AL FCG +GS VGDM L+YG GVYLAGG LP+I D++ S F AR Sbjct: 277 AIAGTDALARRALDVFCGLLGSTVGDMALMYGAHGGVYLAGGILPKIRDYLRDSTFVARY 336 Query: 302 LDKGPLRPALEQVPVRIVEHGQLGVIGAASWFL 334 L+KGP+ AL+++PV++VEHGQLGVIGAASW+L Sbjct: 337 LNKGPMSEALQRIPVKVVEHGQLGVIGAASWYL 369 Lambda K H 0.321 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 374 Length adjustment: 29 Effective length of query: 309 Effective length of database: 345 Effective search space: 106605 Effective search space used: 106605 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory