Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate WP_057687229.1 ABB28_RS15235 D-glycerate dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >NCBI__GCF_001431535.1:WP_057687229.1 Length = 345 Score = 244 bits (622), Expect = 3e-69 Identities = 134/329 (40%), Positives = 202/329 (61%), Gaps = 10/329 (3%) Query: 2 KPKVFITRQIPENGIKMIEKFYEIELWKDPKAPPRGVLLEKVREVDALVTLVTDKVDKEL 61 +P V++++ + + I+ + E+ A + L E++R VD + + +++ Sbjct: 5 RPVVWVSQPLIDAVIEPLRAQVELITTDAVTAWTQEQLAERLRGVDGAIITLNERIGAAQ 64 Query: 62 LENAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIVE 121 L A +L++IA VGY+N+D++ + G+ +NTP VLT+ TADL FALL+A ARRI E Sbjct: 65 LAGADRLQVIANVGVGYNNLDVDALSAAGVLASNTPDVLTETTADLGFALLMAAARRITE 124 Query: 122 ADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKR-AKGFGMKIIYYS 180 ++ ++R G+W + W LG + G TLGI+G GRIGQ +A+R A GFGM+++Y++ Sbjct: 125 SERWLRDGQWGQ----WSFQTMLGADIHGSTLGILGMGRIGQGIARRGAHGFGMRVLYHN 180 Query: 181 RTRKPEAEE-EIGAEYVDFETLLKESDFISLHVPLTKETYHMIGEKELKLMKPNAILINT 239 R+R P A E E+GA+Y + + LL +SD + L +P T ++H+I L MKP A L+N Sbjct: 181 RSRLPAATEAEVGAQYAELDALLAQSDHLVLVLPYTAASHHLINASALAKMKPTATLVNI 240 Query: 240 SRGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEELFKLKNVVLAPHIGSATHEAREG 299 +RG +VD AL AL G +A AGLDV+E EP EL L+NVVL PHIGSA+ R+ Sbjct: 241 ARGGIVDELALADALAHGRLAAAGLDVYEGEPQVRPELLALRNVVLTPHIGSASLGTRKA 300 Query: 300 MAELVAKNLIAF--AKGEIP--PNLVNKD 324 M +L NL+A GE P P+ +N D Sbjct: 301 MVQLAVDNLLAALGVAGEAPRMPSAINAD 329 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 345 Length adjustment: 28 Effective length of query: 303 Effective length of database: 317 Effective search space: 96051 Effective search space used: 96051 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory