Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate WP_057506707.1 ABB28_RS00310 3-hydroxybutyrate dehydrogenase
Query= reanno::pseudo5_N2C3_1:AO356_20240 (272 letters) >NCBI__GCF_001431535.1:WP_057506707.1 Length = 260 Score = 130 bits (328), Expect = 2e-35 Identities = 89/258 (34%), Positives = 130/258 (50%), Gaps = 20/258 (7%) Query: 22 KVVLLTGAAQGIGEAIVAAFASQQARLVISDI-QAQKVEAVAAHWR-ERGADVHALQADV 79 KV ++TG+ GIG I A A Q A +V++ AQ++E + A + + G V AD+ Sbjct: 5 KVAVVTGSTSGIGLGIATALARQGADIVLNGFGDAQEIERIRAGLQADFGVRVAHDGADL 64 Query: 80 SKQQDLQAMARRAVELHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWYGCKA 139 S+ + ++ M AV GRID+LVN AG+ E E W A++L ++ A Sbjct: 65 SRGEAVREMIAHAVAAMGRIDILVNNAGIQHTASIEEFPVEKWDAILALNLSAVFHATAA 124 Query: 140 VLPQMIEQGVGSIINIASVHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRVNAIA 199 LP M +QG G IINIASVH Y AKHG++G T+A +E A G+ NAI Sbjct: 125 ALPCMKQQGAGRIINIASVHGLVASVNKAAYVTAKHGVVGFTKATALETAGTGITANAIC 184 Query: 200 PGYIETQLNVDYWNGFADPH------------AERQRALDLHPPRRVGQPIEVAMTAVFL 247 PG++ T L A+ AE+Q +L P ++G+ + VFL Sbjct: 185 PGWVRTALVEQQITALAEREGTDQESAARALLAEKQPSLQFVTPEQLGEMV------VFL 238 Query: 248 ASDEAPFINASCITIDGG 265 ASD A + + + +DGG Sbjct: 239 ASDAAAQMTGTALPMDGG 256 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 260 Length adjustment: 25 Effective length of query: 247 Effective length of database: 235 Effective search space: 58045 Effective search space used: 58045 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory