Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate WP_057509057.1 ABB28_RS13185 short-chain dehydrogenase
Query= reanno::pseudo5_N2C3_1:AO356_20240 (272 letters) >NCBI__GCF_001431535.1:WP_057509057.1 Length = 255 Score = 213 bits (541), Expect = 4e-60 Identities = 120/256 (46%), Positives = 160/256 (62%), Gaps = 10/256 (3%) Query: 17 ERLKDKVVLLTGAAQGIGEAIVAAFASQQARLVISDIQAQKVE-AVAAHWRERGADVHAL 75 +RL KV ++TGAA GIG AI F S A + D A + AV A ++ Sbjct: 9 QRLAGKVAIVTGAANGIGAAIAGLFQSHGAIVAGYDQAAPGADDAVCALFQ--------- 59 Query: 76 QADVSKQQDLQAMARRAVELHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGAWY 135 Q DVS + A R V +G++DVLV+ AG++VF PLE++ + W+R ++L G W Sbjct: 60 QGDVSDADAVAAFVERVVSAYGQVDVLVSNAGMDVFSIPLELSSQTWQRNLDVNLGGHWN 119 Query: 136 GCKAVLPQMIEQGVGSIINIASVHSSHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGVRV 195 +AVLP M+ QG GS++NIASVH II G FPY VAKH L+GLT+ALG+EYA KG+R Sbjct: 120 FARAVLPCMLRQGRGSVVNIASVHGHRIIQGAFPYNVAKHALIGLTKALGLEYADKGLRF 179 Query: 196 NAIAPGYIETQLNVDYWNGFADPHAERQRALDLHPPRRVGQPIEVAMTAVFLASDEAPFI 255 N+I+PG I ++ DP R+ L PP+R+G+ EVA TA+FLASDEA FI Sbjct: 180 NSISPGLILVDRIEHWFESQPDPAQARREQEALLPPKRIGEASEVAQTALFLASDEARFI 239 Query: 256 NASCITIDGGRSVMYH 271 NA+ I IDGGRS +Y+ Sbjct: 240 NAADILIDGGRSQLYY 255 Lambda K H 0.321 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 255 Length adjustment: 25 Effective length of query: 247 Effective length of database: 230 Effective search space: 56810 Effective search space used: 56810 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory