Align 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 (characterized)
to candidate WP_057509166.1 ABB28_RS13775 aspartate aminotransferase family protein
Query= SwissProt::P22256 (426 letters) >NCBI__GCF_001431535.1:WP_057509166.1 Length = 408 Score = 215 bits (548), Expect = 2e-60 Identities = 139/400 (34%), Positives = 204/400 (51%), Gaps = 37/400 (9%) Query: 25 IFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQVLAYE 84 + +R + RVWD +GREY+D A GIAV GH P + AA+ Q KL HT V Sbjct: 24 VVLERGQGARVWDSQGREYIDLAAGIAVCGLGHNDPDLTAALVEQAGKLWHTS-NVFYSA 82 Query: 85 PYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVKIARAATKRSGT-------IAFSGA 137 P L L E + + FA++ L +G+EA E A+K+ R G + F G+ Sbjct: 83 PPLHLAEELVKA--SRFAERVFLCNSGAEANEVAIKMVRKWASSQGRPADRRVIVTFRGS 140 Query: 138 YHGRTHYTLALTGKVNP-YSAGMGLMP-GHVYRALYPCPLHGISEDDAIASIHRIFKNDA 195 +HGRT A+T P Y G +P G Y + +D + + Sbjct: 141 FHGRT--LAAVTATAQPKYQEGYEPLPQGFRY----------VDFNDEVQ-----LETAM 183 Query: 196 APEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGAGRTGTLFAME 255 A D+AA+++EPVQGEGG + P F++R+R LCD+HG +L+ DE+Q+G GRTGTLFA Sbjct: 184 AAGDVAAVMLEPVQGEGGVMPARPGFLKRVRELCDQHGALLVLDEIQAGMGRTGTLFAHW 243 Query: 256 QMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAGNPIACVAALEVLKVF 315 Q GV PD+ T AK++ GGFP+ + +V + + G G T+ GNP+A A L+ Sbjct: 244 QDGVVPDMVTLAKALGGGFPIGAMLAGPKVAETMQFGAHGTTFGGNPLAAAVARVALRKL 303 Query: 316 EQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELFEDGDHNKPDAKLTAE 375 + + + + L++G I + G VRG G M+ L +K Sbjct: 304 ASDEIAANVDRQSRALREGFERINAEFGVFGQVRGRGLMLGAVL------SKDHLGQAGV 357 Query: 376 IVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLE 415 I+ A + GL+ L GP +VLR + L I D +I +GL+ Sbjct: 358 ILDHAAEHGLLTLQAGP--DVLRFVPSLNITDEEIAEGLK 395 Lambda K H 0.320 0.137 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 425 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 408 Length adjustment: 31 Effective length of query: 395 Effective length of database: 377 Effective search space: 148915 Effective search space used: 148915 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory