Align gamma-glutamylputrescine oxidase (EC 1.4.3.-) (characterized)
to candidate WP_057507760.1 ABB28_RS05940 FAD-binding oxidoreductase
Query= reanno::pseudo5_N2C3_1:AO356_21495 (427 letters) >NCBI__GCF_001431535.1:WP_057507760.1 Length = 435 Score = 339 bits (869), Expect = 1e-97 Identities = 174/405 (42%), Positives = 255/405 (62%), Gaps = 2/405 (0%) Query: 7 PESYYAASANPVPPRPALQDDVETDVCVIGAGYTGLSSALFLLENGFKVTVLEAAKVGFG 66 P S+YAAS P +P L DV+ DV ++GAGYTGLS+AL L G +V VL+A +VG+G Sbjct: 16 PPSWYAASVAPRVAQPPLDGDVQVDVAILGAGYTGLSAALELARRGLRVVVLDACRVGWG 75 Query: 67 ASGRNGGQIVNSYSRDIDVIERSVGPQQAQLLGNMAFEGGRIIRERVAKYQIQCDLKDGG 126 ASGRNGGQ + Y ++DV+E+ VG + A+ L + + +G +++R+R+ +Y+I C G Sbjct: 76 ASGRNGGQALVGYGCEVDVLEKQVGVEDARTLFDYSRQGVQLLRDRIDQYRIDCHWVPGH 135 Query: 127 VFAALTAKQMGHLE-SQKRLWERFGHTQLELLDQRRIREVVACEEYVGGMLDMSGGHIHP 185 +T +Q L+ +RL R+ + ++ D+ +R + Y G M D GH+HP Sbjct: 136 ANVPITTRQSQALQRDMERLTTRYDYP-MQWWDRATLRAQLDSPRYQGAMFDPLSGHLHP 194 Query: 186 LNLALGEAAAVESLGGVIYEQSPAVRIERGASPVVHTPQGKVRAKFIIVAGNAYLGNLVP 245 L A G A A + G VI+E +P + ++R P + T G V A +++AGNA+L + P Sbjct: 195 LAYAQGLADAAIAAGAVIHEHTPVLELQRTPHPALRTATGTVHAAHVLLAGNAWLEGIAP 254 Query: 246 ELAAKSMPCGTQVIATEPLGDELAHSLLPQDYCVEDCNYLLDYYRLTGDKRLIFGGGVVY 305 EL MP GT V AT LG+ A +L+ D V D +LDY+RL+ D R++FGGG Y Sbjct: 255 ELERHVMPVGTYVGATPVLGEARARALIRNDMAVSDTGLVLDYFRLSHDHRVLFGGGASY 314 Query: 306 GARDPANIEAIIRPKMLKAFPQLKDVKIDYAWTGNFLLTLSRLPQVGRLGDNIYYSQGCS 365 +R PA ++++++ ++ + FPQL+ V ++Y W G +T SR P GRL +IY++QG S Sbjct: 315 SSRPPAGLDSVMQRRLWQVFPQLQGVPLEYLWGGYVDITPSRAPHWGRLTPDIYFAQGFS 374 Query: 366 GHGVTYTHLAGKVLAEALRGQAERFDAFADLPHYPFPGGQLLRTP 410 GHGV +LAG+V+AEA+ GQA R D F LPH PFPGG+LLRTP Sbjct: 375 GHGVAAANLAGQVIAEAIAGQAARLDVFERLPHRPFPGGRLLRTP 419 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 571 Number of extensions: 34 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 435 Length adjustment: 32 Effective length of query: 395 Effective length of database: 403 Effective search space: 159185 Effective search space used: 159185 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory