Align Beta-N-acetylglucosaminidase/beta-glucosidase; 3-beta-N-acetyl-D-glucosaminidase/beta-D-glucosidase; Nag3; EC 3.2.1.21; EC 3.2.1.52 (characterized)
to candidate WP_057507288.1 ABB28_RS03435 beta-N-acetylhexosaminidase
Query= SwissProt::Q7WUL3 (564 letters) >NCBI__GCF_001431535.1:WP_057507288.1 Length = 335 Score = 107 bits (267), Expect = 7e-28 Identities = 102/344 (29%), Positives = 144/344 (41%), Gaps = 51/344 (14%) Query: 57 VGGVML--RTMTAADAAATVTT-LQSTATVPLLISANLEGGASQTVQEA-------THVG 106 V GV+L R + A ++ ++ A P LI + EGG Q +E +G Sbjct: 24 VAGVVLFKRNFASRQQIAELSAAIREAAPRPQLICVDQEGGRVQRFREGFTDLPPLQQIG 83 Query: 107 SNMALAATGSTDHVRRAATVIGREARALGINWAFTPVVDIDLNFRNPITNTRTFGADAAT 166 A + + A ++ E RA G++ +F PVVD L N R F D Sbjct: 84 LGHAQDPQAALAAAEQHAWLMASEVRASGVDLSFAPVVD--LGHGNRAIGDRAFSEDPQV 141 Query: 167 VAAMGAEYVEAIQAQGLAASAKHFPGDGVDERDQHLLASVNTMSVEEWDDSFGVVYRAAI 226 VAA A YV + + G+AA+ KHFPG G D H+ +++ ++E V + A I Sbjct: 142 VAAFTAAYVRGMHSAGMAATLKHFPGHGSVLEDTHVDTAIDPRGLDELQQRDLVPFVAGI 201 Query: 227 AAGVKTVMVGHIMLPAYSRALRPGVADRDILPGVVAEELLNDLLRDRLGFNGLVVSDSTT 286 AAG VM+ H++ P + P + + D+LR +LGF G+V SD Sbjct: 202 AAGADAVMMAHVIYPQVAPE-----------PAGYSRRWVQDILRGQLGFRGVVFSDDIG 250 Query: 287 MAGLASVLPRSQAVPRVIAAGCDMFLFTKNLDEDFGYMRAGIRDGVITPERLDEAVT--- 343 MA S V + AGCD+ L V PE +D+A+ Sbjct: 251 MAASFSAGGVKARVDAHLDAGCDVVL-------------------VCHPELVDDALQAMQ 291 Query: 344 -RILALKASLGL-HRGTNLPAQGAAGVLADPDHSATAREVAASS 385 R A LGL RG A G G+LAD H T SS Sbjct: 292 HRTSNTAALLGLIGRG----ALGWDGLLADARHGDTRTRFLESS 331 Lambda K H 0.318 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 448 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 564 Length of database: 335 Length adjustment: 32 Effective length of query: 532 Effective length of database: 303 Effective search space: 161196 Effective search space used: 161196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory