Align isocitrate dehydrogenase (NAD+) (EC 1.1.1.41) (characterized)
to candidate WP_057506985.1 ABB28_RS01900 isocitrate dehydrogenase
Query= BRENDA::Q945K7 (374 letters) >NCBI__GCF_001431535.1:WP_057506985.1 Length = 334 Score = 310 bits (793), Expect = 5e-89 Identities = 161/330 (48%), Positives = 217/330 (65%), Gaps = 3/330 (0%) Query: 47 TLFPGDGIGPEIAESVKKVFTTAGVPIEWEEHYVGTEIDPRTQSFLTWESLESVRRNKVG 106 T+ GDGIGPEI ++ V +E+E+ G + + +LES+ RNK+ Sbjct: 6 TVIRGDGIGPEIMDATLYVLDKLNAGLEYEDADAGLVALEKHGDLMPASTLESIARNKIA 65 Query: 107 LKGPMATPIGKGHRSLNLTLRKELNLYANVRPCYSLPGYKTRYDDVDLITIRENTEGEY- 165 LK P++TPIG G S+N++LR+ +LYANVRP ++ P K+R+D+V+L+T+RENTEG Y Sbjct: 66 LKSPLSTPIGGGFTSINVSLRRHFDLYANVRPAHTFPNTKSRFDNVNLVTVRENTEGAYL 125 Query: 166 -SGLEHQVVRGVVESLKIITRQASLRVAEYAFLYAKTHGRERVSAIHKANIMQKTDGLFL 224 G E S ITR+ S R+ YAF A++ GR++V+A+HKANI++ T GLFL Sbjct: 126 AEGQEVSPDGETAFSGTRITRKGSERIVRYAFELARSTGRKKVTAVHKANIIKSTSGLFL 185 Query: 225 KCCREVAEKYPEITYEEVVIDNCCMMLVKNPALFDVLVMPNLYGDIISDLCAGLVGGLGL 284 REVA KYP+I ++E+++DNCCM LV P FDV+V NL+GDIISDLCAGLVGGLGL Sbjct: 186 AVAREVAAKYPDIEFQEMIVDNCCMQLVMRPEQFDVIVTTNLFGDIISDLCAGLVGGLGL 245 Query: 285 TPSCNIGEDGVALAEAVHGSAPDIAGKNLANPTALLLSGVMMLRHLKFNEQAEQIHSAII 344 P NIGE+ A+ EAVHG+APDIAG+ ANP ALLL+ ML H+ E AE++ AI+ Sbjct: 246 APGANIGEN-AAIFEAVHGTAPDIAGQGKANPCALLLAAAQMLDHIGQPENAERLRKAIV 304 Query: 345 NTIAEGKYRTADLGGSSTTTEFTKAICDHL 374 T+ T DLGG+ T F +AI L Sbjct: 305 ATLEAKDSLTGDLGGTGNTMGFAQAIASRL 334 Lambda K H 0.318 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 334 Length adjustment: 29 Effective length of query: 345 Effective length of database: 305 Effective search space: 105225 Effective search space used: 105225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory