Align homoisocitrate dehydrogenase (EC 1.1.1.87) (characterized)
to candidate WP_057509305.1 ABB28_RS14510 3-isopropylmalate dehydrogenase
Query= BRENDA::Q5SIJ1 (334 letters) >NCBI__GCF_001431535.1:WP_057509305.1 Length = 354 Score = 198 bits (503), Expect = 2e-55 Identities = 145/356 (40%), Positives = 193/356 (54%), Gaps = 27/356 (7%) Query: 1 MAYRICLIEGDGIGHEVIPAARRVLEATGL----PLEFVEAEAGWETFERRGTSVPEETV 56 M I ++ GDGIG EV AA VLEA F E + G +R G +P T+ Sbjct: 1 MHAEIVVLPGDGIGPEVAAAAVAVLEAVATRFNHTFNFNEHDIGGIAIDRHGEPLPASTL 60 Query: 57 EKILSCHATLFGAA-----TSPTRKVPGFFGAIRYLRRRLDLYANVRPAKSRPVP-GSRP 110 + + A L GA + P KV G + +RR L LYAN+RP ++ G+ P Sbjct: 61 DACRAADAILLGAVGGPKWSDPNAKVRPEQGLLA-IRRALGLYANLRPVRTHEAALGASP 119 Query: 111 -------GVDLVIVRENTEGLYVEQERRYLDVAIADAVISKKASERIGRAALRIAEGRPR 163 GVD V+VRE T G+Y ++ R D A S + ER+ R+A +A R Sbjct: 120 IKAELLRGVDFVVVRELTGGIYFGEKTRTADAASDLCSYSVEEIERVLRSAFELARQRRG 179 Query: 164 KTLHIAHKANVLPLTQGLFLDTVKEVAKD-FPLVNVQDIIVDNCAMQLVMRPERFDVIVT 222 K + KANVL T L+ D + +D FP V ++ +VD+ AM L+ +P +DVIVT Sbjct: 180 KVTSV-DKANVLE-TSRLWRDVATRLGRDVFPDVALEHQLVDSMAMHLLAKPREYDVIVT 237 Query: 223 TNLLGDILSDLAAGLVGGLGLAPSGNIGDTTAV--FEPVHGSAPDIAGKGIANPTAAILS 280 N+ GDIL+D A+ L G LGL PS ++G AV +EP+HGSAPDIAGKGIANP A I S Sbjct: 238 ENMFGDILTDEASMLAGSLGLLPSASLGQPGAVGIYEPIHGSAPDIAGKGIANPYATIFS 297 Query: 281 AAMMLDY-LGEKEAAKRVEKAVDLVLERGPRTPDL---GGDATTEAFTEAVVEALK 332 AAM+L + LG + A VE AV L+ G T DL G +T T AV+E L+ Sbjct: 298 AAMLLRHSLGLEAEAAAVEAAVHAALDAGVFTADLAAAGAAVSTAEATAAVLERLQ 353 Lambda K H 0.319 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 354 Length adjustment: 29 Effective length of query: 305 Effective length of database: 325 Effective search space: 99125 Effective search space used: 99125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory