Align Concentrative nucleoside transporter, CNT, of 418 aas and 12 TMSs. A repeat-swapped model of VcCNT predicts that nucleoside transport occurs via a mechanism involving an elevator-like substrate binding domain movement across the membrane (characterized)
to candidate WP_057507837.1 ABB28_RS06365 Na+ dependent nucleoside transporter domain-containing protein
Query= TCDB::Q9KPL5 (418 letters) >NCBI__GCF_001431535.1:WP_057507837.1 Length = 432 Score = 364 bits (934), Expect = e-105 Identities = 195/427 (45%), Positives = 280/427 (65%), Gaps = 22/427 (5%) Query: 7 LIGMAVLLGIAVLLSSNRKAINLRTVGGAFAIQFSLGAFILYVPWGQELLRGFSDAVSNV 66 L G+AVL+GI L S+N++A++ + V +Q + A +L VP G+++ V Sbjct: 12 LFGLAVLIGITWLFSNNKRAVDWKLVATGLLLQIAFAAVVLLVPGGRDVFDALGHGFVKV 71 Query: 67 INYGNDGTSFLFGGLVSGKMFEVFGGGGFIFAFRVLPTLIFFSALISVLYYLGVMQWVIR 126 +++ N+G+ F+FG L++ + + GFIFAF+VLPT+IFFSAL+ VLY+L VMQ ++R Sbjct: 72 LSFVNEGSGFIFGSLMNVESY------GFIFAFQVLPTIIFFSALMGVLYHLNVMQAIVR 125 Query: 127 ILGGGLQKALGTSRAESMSAAANIFVGQTEAPLVVRPFVPKMTQSELFAVMCGGLASIAG 186 ++ + K + S AE+ S A++F+GQTEAPL VRP++ +MT+SEL +M GG+A IAG Sbjct: 126 VMALAITKVMRVSGAETTSVCASVFIGQTEAPLTVRPYISRMTESELLTMMIGGMAHIAG 185 Query: 187 GVLAGYASM---------GVKIEYLVAASFMAAPGGLLFAKLMMPETEKPQDNEDITLDG 237 GVLA Y M ++L+AAS MAAP L+ AKL++PET P + ++ Sbjct: 186 GVLAAYVGMLGGGDPESQAFYAKHLLAASIMAAPATLVVAKLLIPETGTPLTRGTVKME- 244 Query: 238 GDDKPANVIDAAAGGASAGLQLALNVGAMLIAFIGLIALINGMLGGIGGWFGMP-----E 292 + +N+IDAAAGGA+ GL+LALN+GAML+AFI LIAL+N L IG G+ Sbjct: 245 VEKTSSNIIDAAAGGAADGLRLALNIGAMLLAFIALIALLNAPLTWIGDVTGLAAAIGRP 304 Query: 293 LKLEMLLGWLFAPLAFLIGVPWNEATVAGEFIGLKTVANEFVAYSQFAPYLTEAAP-VVL 351 L + G+L AP+A++IG PW +A+ G IG K V NEFVAYS+ + + P V L Sbjct: 305 TNLSTIFGYLLAPIAWVIGTPWADASTVGSLIGQKVVINEFVAYSELSRIINGQVPGVTL 364 Query: 352 SEKTKAIISFALCGFANLSSIAILLGGLGSLAPKRRGDIARMGVKAVIAGTLSNLMAATI 411 SE+ + I ++ALCGFAN SSIAI +GG+G LAP+RR D+AR G++AV+ GT++ M ATI Sbjct: 365 SEEGRLIATYALCGFANFSSIAIQIGGIGGLAPERRQDLARFGLRAVLGGTIATFMTATI 424 Query: 412 AGFFLSF 418 AG F Sbjct: 425 AGVLTHF 431 Lambda K H 0.325 0.141 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 545 Number of extensions: 32 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 432 Length adjustment: 32 Effective length of query: 386 Effective length of database: 400 Effective search space: 154400 Effective search space used: 154400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory