Align alcohol dehydrogenase (EC 1.1.1.1) (characterized)
to candidate WP_057509057.1 ABB28_RS13185 short-chain dehydrogenase
Query= BRENDA::Q4J9F2 (255 letters) >NCBI__GCF_001431535.1:WP_057509057.1 Length = 255 Score = 150 bits (379), Expect = 2e-41 Identities = 96/254 (37%), Positives = 136/254 (53%), Gaps = 11/254 (4%) Query: 4 QSLKNKVVIVTGAGSGIGRAIAKKFALNDSIVVAVELLEDRLNQIVQELRGMGKEVLGVK 63 Q L KV IVTGA +GIG AIA F + +IV + + V L G Sbjct: 9 QRLAGKVAIVTGAANGIGAAIAGLFQSHGAIVAGYDQAAPGADDAVCALFQQG------- 61 Query: 64 ADVSKKKDVEEFVRRTFETYSRIDVLCNNAGIMDGVTPVAEVSDELWERVLAVNLYSAFY 123 DVS V FV R Y ++DVL +NAG MD + E+S + W+R L VNL + Sbjct: 62 -DVSDADAVAAFVERVVSAYGQVDVLVSNAG-MDVFSIPLELSSQTWQRNLDVNLGGHWN 119 Query: 124 SSRAVIPIMLKQGKGVIVNTASIAGIRGGFAGAPYTVAKHGLIGLTRSIAAHYGDQGIRA 183 +RAV+P ML+QG+G +VN AS+ G R PY VAKH LIGLT+++ Y D+G+R Sbjct: 120 FARAVLPCMLRQGRGSVVNIASVHGHRIIQGAFPYNVAKHALIGLTKALGLEYADKGLRF 179 Query: 184 VAVLPGTVKTN--IGLGSSKPSELGMRTLTKLMSLSSRLAEPEDIANVIVFLASDEASFV 241 ++ PG + + S+P R + + R+ E ++A +FLASDEA F+ Sbjct: 180 NSISPGLILVDRIEHWFESQPDPAQARREQEALLPPKRIGEASEVAQTALFLASDEARFI 239 Query: 242 NGDAVVVDGGLTVL 255 N +++DGG + L Sbjct: 240 NAADILIDGGRSQL 253 Lambda K H 0.318 0.135 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 255 Length adjustment: 24 Effective length of query: 231 Effective length of database: 231 Effective search space: 53361 Effective search space used: 53361 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory